| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13169 | g13169.t45 | TSS | g13169.t45 | 28316629 | 28316629 |
| chr_1 | g13169 | g13169.t45 | isoform | g13169.t45 | 28316740 | 28317634 |
| chr_1 | g13169 | g13169.t45 | exon | g13169.t45.exon1 | 28316740 | 28316764 |
| chr_1 | g13169 | g13169.t45 | cds | g13169.t45.CDS1 | 28316740 | 28316764 |
| chr_1 | g13169 | g13169.t45 | exon | g13169.t45.exon2 | 28316833 | 28316883 |
| chr_1 | g13169 | g13169.t45 | cds | g13169.t45.CDS2 | 28316833 | 28316883 |
| chr_1 | g13169 | g13169.t45 | exon | g13169.t45.exon3 | 28316964 | 28317339 |
| chr_1 | g13169 | g13169.t45 | cds | g13169.t45.CDS3 | 28316964 | 28317339 |
| chr_1 | g13169 | g13169.t45 | exon | g13169.t45.exon4 | 28317531 | 28317634 |
| chr_1 | g13169 | g13169.t45 | cds | g13169.t45.CDS4 | 28317531 | 28317549 |
| chr_1 | g13169 | g13169.t45 | TTS | g13169.t45 | 28317861 | 28317861 |
>g13169.t45 Gene=g13169 Length=556
ATGTCTCTTACTTGGACTTTAATCGCTGGATTTTTGTATGCTGAAGTTGCTGTTGTTCTT
TTATTAGTATTGCCTGTCTTTAGTGCATCCAAATGGAATCGTTTCTTCAAATCAAGATTT
CTGTCAGCTCTCTCTCGGCAAGCACAGATTTACTTTTATTTGATGCTTGGTGTTTTGGTA
ATCTTTTTGCTTGAGGCTATTAGAGAAATGCGTAAATACAGCAGCAGTGAAGAGGAAACT
ACTCTTAATTTGGGAATGCAACATTCAATGAGACTCTTCCGTGCTCAACGCAACTTTTAC
ATCTCTGGGTTTGCCATTTTCTTGTCATTGGTCATTAGACGATTGATTATTTTAATCACA
ACACAAGCATCGTTAATTGCAAATTCTGAAGCAAGCATGAAACAAGCACAGTCCGCAACA
CAGGTAAAAGAATACAATGTTAATTACATTATCATTAAAATCGCAAGCTGATTCACTCAA
CAGAGAATATGATCGATTGACAGAAGAGTACAGCAAATTGCAGAACAAGCAGGCTGCTGG
TGACAAGTCAGACTAA
>g13169.t45 Gene=g13169 Length=156
MSLTWTLIAGFLYAEVAVVLLLVLPVFSASKWNRFFKSRFLSALSRQAQIYFYLMLGVLV
IFLLEAIREMRKYSSSEEETTLNLGMQHSMRLFRAQRNFYISGFAIFLSLVIRRLIILIT
TQASLIANSEASMKQAQSATQVKEYNVNYIIIKIAS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g13169.t45 | PANTHER | PTHR12701:SF50 | LP10861P | 1 | 144 | 1.9E-54 |
| 3 | g13169.t45 | PANTHER | PTHR12701 | BCR-ASSOCIATED PROTEIN, BAP | 1 | 144 | 1.9E-54 |
| 1 | g13169.t45 | Pfam | PF05529 | Bap31/Bap29 transmembrane region | 1 | 131 | 1.0E-41 |
| 7 | g13169.t45 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 6 | - |
| 11 | g13169.t45 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 30 | - |
| 10 | g13169.t45 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 31 | 49 | - |
| 12 | g13169.t45 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 67 | - |
| 8 | g13169.t45 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 68 | 98 | - |
| 13 | g13169.t45 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 99 | 119 | - |
| 9 | g13169.t45 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 120 | 156 | - |
| 4 | g13169.t45 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 29 | - |
| 6 | g13169.t45 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 49 | 67 | - |
| 5 | g13169.t45 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 99 | 121 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006886 | intracellular protein transport | BP |
| GO:0005783 | endoplasmic reticulum | CC |
| GO:0016021 | integral component of membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.