Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative B-cell receptor-associated protein 31.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g13169 g13169.t47 TSS g13169.t47 28316629 28316629
chr_1 g13169 g13169.t47 isoform g13169.t47 28316740 28317634
chr_1 g13169 g13169.t47 exon g13169.t47.exon1 28316740 28316764
chr_1 g13169 g13169.t47 cds g13169.t47.CDS1 28316740 28316764
chr_1 g13169 g13169.t47 exon g13169.t47.exon2 28316833 28316883
chr_1 g13169 g13169.t47 cds g13169.t47.CDS2 28316833 28316883
chr_1 g13169 g13169.t47 exon g13169.t47.exon3 28316964 28317310
chr_1 g13169 g13169.t47 cds g13169.t47.CDS3 28316964 28317310
chr_1 g13169 g13169.t47 exon g13169.t47.exon4 28317377 28317585
chr_1 g13169 g13169.t47 cds g13169.t47.CDS4 28317377 28317585
chr_1 g13169 g13169.t47 exon g13169.t47.exon5 28317630 28317634
chr_1 g13169 g13169.t47 cds g13169.t47.CDS5 28317630 28317633
chr_1 g13169 g13169.t47 TTS g13169.t47 28317861 28317861

Sequences

>g13169.t47 Gene=g13169 Length=637
ATGTCTCTTACTTGGACTTTAATCGCTGGATTTTTGTATGCTGAAGTTGCTGTTGTTCTT
TTATTAGTATTGCCTGTCTTTAGTGCATCCAAATGGAATCGTTTCTTCAAATCAAGATTT
CTGTCAGCTCTCTCTCGGCAAGCACAGATTTACTTTTATTTGATGCTTGGTGTTTTGGTA
ATCTTTTTGCTTGAGGCTATTAGAGAAATGCGTAAATACAGCAGCAGTGAAGAGGAAACT
ACTCTTAATTTGGGAATGCAACATTCAATGAGACTCTTCCGTGCTCAACGCAACTTTTAC
ATCTCTGGGTTTGCCATTTTCTTGTCATTGGTCATTAGACGATTGATTATTTTAATCACA
ACACAAGCATCGTTAATTGCAAATTCTGAAGCAAGCATGAAACAAGCACAGTCCGCAACA
CAGGCTGCTCGTCATTTAATGGCCGAAAAGAAAACTGATGGTGGTTCTGCTAACACTGCT
AATAGTGATAATAAAGCTGATGATGATAAGGAAAAATTACAAAACAAGATTAAAGAATTG
GAAGCTGAATTGAAAAAGGAACGAAAGGATAAAGAAGCATTAAAATCGCAAGCTGATTCA
CTCAACAGAGAATATGATCGATTGACAGAAGAACTAA

>g13169.t47 Gene=g13169 Length=212
MSLTWTLIAGFLYAEVAVVLLLVLPVFSASKWNRFFKSRFLSALSRQAQIYFYLMLGVLV
IFLLEAIREMRKYSSSEEETTLNLGMQHSMRLFRAQRNFYISGFAIFLSLVIRRLIILIT
TQASLIANSEASMKQAQSATQAARHLMAEKKTDGGSANTANSDNKADDDKEKLQNKIKEL
EAELKKERKDKEALKSQADSLNREYDRLTEEL

Protein features from InterProScan

Transcript Database ID Name Start End E.value
10 g13169.t47 Coils Coil Coil 163 211 -
8 g13169.t47 MobiDBLite mobidb-lite consensus disorder prediction 138 174 -
9 g13169.t47 MobiDBLite mobidb-lite consensus disorder prediction 186 212 -
3 g13169.t47 PANTHER PTHR12701:SF50 LP10861P 1 212 2.4E-72
4 g13169.t47 PANTHER PTHR12701 BCR-ASSOCIATED PROTEIN, BAP 1 212 2.4E-72
2 g13169.t47 Pfam PF05529 Bap31/Bap29 transmembrane region 1 131 2.7E-41
1 g13169.t47 Pfam PF18035 Bap31/Bap29 cytoplasmic coiled-coil domain 175 211 4.1E-13
11 g13169.t47 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 6 -
15 g13169.t47 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 7 30 -
14 g13169.t47 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 31 49 -
16 g13169.t47 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 50 67 -
12 g13169.t47 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 68 98 -
17 g13169.t47 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 99 119 -
13 g13169.t47 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 120 212 -
5 g13169.t47 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 7 29 -
7 g13169.t47 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 49 67 -
6 g13169.t47 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 98 117 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0006886 intracellular protein transport BP
GO:0005783 endoplasmic reticulum CC
GO:0016021 integral component of membrane CC

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values