General information for g13169.t58
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative B-cell receptor-associated protein 31.
Parent gene
- The parent gene g13169 is located on chr_1: 28316986..28327569 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13169 | g13169.t58 | TSS | g13169.t58 | 28316629 | 28316629 |
| chr_1 | g13169 | g13169.t58 | isoform | g13169.t58 | 28316740 | 28317858 |
| chr_1 | g13169 | g13169.t58 | exon | g13169.t58.exon1 | 28316740 | 28316764 |
| chr_1 | g13169 | g13169.t58 | cds | g13169.t58.CDS1 | 28316740 | 28316764 |
| chr_1 | g13169 | g13169.t58 | exon | g13169.t58.exon2 | 28316833 | 28316883 |
| chr_1 | g13169 | g13169.t58 | cds | g13169.t58.CDS2 | 28316833 | 28316883 |
| chr_1 | g13169 | g13169.t58 | exon | g13169.t58.exon3 | 28316964 | 28317310 |
| chr_1 | g13169 | g13169.t58 | cds | g13169.t58.CDS3 | 28316964 | 28317310 |
| chr_1 | g13169 | g13169.t58 | exon | g13169.t58.exon4 | 28317404 | 28317858 |
| chr_1 | g13169 | g13169.t58 | cds | g13169.t58.CDS4 | 28317404 | 28317634 |
| chr_1 | g13169 | g13169.t58 | TTS | g13169.t58 | 28317861 | 28317861 |
Sequences
>g13169.t58 Gene=g13169 Length=878
ATGTCTCTTACTTGGACTTTAATCGCTGGATTTTTGTATGCTGAAGTTGCTGTTGTTCTT
TTATTAGTATTGCCTGTCTTTAGTGCATCCAAATGGAATCGTTTCTTCAAATCAAGATTT
CTGTCAGCTCTCTCTCGGCAAGCACAGATTTACTTTTATTTGATGCTTGGTGTTTTGGTA
ATCTTTTTGCTTGAGGCTATTAGAGAAATGCGTAAATACAGCAGCAGTGAAGAGGAAACT
ACTCTTAATTTGGGAATGCAACATTCAATGAGACTCTTCCGTGCTCAACGCAACTTTTAC
ATCTCTGGGTTTGCCATTTTCTTGTCATTGGTCATTAGACGATTGATTATTTTAATCACA
ACACAAGCATCGTTAATTGCAAATTCTGAAGCAAGCATGAAACAAGCACAGTCCGCAACA
CAGAAAACTGATGGTGGTTCTGCTAACACTGCTAATAGTGATAATAAAGCTGATGATGAT
AAGGAAAAATTACAAAACAAGATTAAAGAATTGGAAGCTGAATTGAAAAAGGAACGAAAG
GATAAAGAAGCATTAAAATCGCAAGCTGATTCACTCAACAGAGAATATGATCGATTGACA
GAAGAGTACAGCAAATTGCAGAACAAGCAGGCTGCTGGTGACAAGTCAGACTAAGCTATT
CGAATATTTGTGCATCACGTACTTGTCATTTTTTCTCATGAAATTTTAATACACTGTATG
AGGTTCTAATTCTTCTTCTTCTTACCTTTAACCGATGATTCACTTTAAAAACAAAATATG
AAATAAATATTATTAGCTTTGATAATTTATATTTTCCTAATGTATGTTTCTTACAAAAGA
GAGAAAAAAGAGAATTAAACAATAAAACTTGATAAAAA
>g13169.t58 Gene=g13169 Length=217
MSLTWTLIAGFLYAEVAVVLLLVLPVFSASKWNRFFKSRFLSALSRQAQIYFYLMLGVLV
IFLLEAIREMRKYSSSEEETTLNLGMQHSMRLFRAQRNFYISGFAIFLSLVIRRLIILIT
TQASLIANSEASMKQAQSATQKTDGGSANTANSDNKADDDKEKLQNKIKELEAELKKERK
DKEALKSQADSLNREYDRLTEEYSKLQNKQAAGDKSD
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g13169.t58 | Coils | Coil | Coil | 154 | 209 | - |
| 10 | g13169.t58 | Gene3D | G3DSA:1.20.5.110 | - | 147 | 206 | 1.4E-5 |
| 8 | g13169.t58 | MobiDBLite | mobidb-lite | consensus disorder prediction | 137 | 153 | - |
| 9 | g13169.t58 | MobiDBLite | mobidb-lite | consensus disorder prediction | 137 | 165 | - |
| 3 | g13169.t58 | PANTHER | PTHR12701:SF50 | LP10861P | 1 | 211 | 3.6E-73 |
| 4 | g13169.t58 | PANTHER | PTHR12701 | BCR-ASSOCIATED PROTEIN, BAP | 1 | 211 | 3.6E-73 |
| 2 | g13169.t58 | Pfam | PF05529 | Bap31/Bap29 transmembrane region | 1 | 131 | 2.9E-41 |
| 1 | g13169.t58 | Pfam | PF18035 | Bap31/Bap29 cytoplasmic coiled-coil domain | 166 | 217 | 8.8E-18 |
| 12 | g13169.t58 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 6 | - |
| 16 | g13169.t58 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 30 | - |
| 15 | g13169.t58 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 31 | 49 | - |
| 17 | g13169.t58 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 67 | - |
| 13 | g13169.t58 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 68 | 98 | - |
| 18 | g13169.t58 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 99 | 119 | - |
| 14 | g13169.t58 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 120 | 217 | - |
| 5 | g13169.t58 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 29 | - |
| 7 | g13169.t58 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 49 | 67 | - |
| 6 | g13169.t58 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 98 | 117 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006886 | intracellular protein transport | BP |
| GO:0005783 | endoplasmic reticulum | CC |
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K14009 (B-cell receptor-associated protein 31)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed