Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g13169 g13169.t60 TSS g13169.t60 28316629 28316629
chr_1 g13169 g13169.t60 isoform g13169.t60 28316740 28317858
chr_1 g13169 g13169.t60 exon g13169.t60.exon1 28316740 28316764
chr_1 g13169 g13169.t60 exon g13169.t60.exon2 28316833 28316873
chr_1 g13169 g13169.t60 exon g13169.t60.exon3 28316964 28317310
chr_1 g13169 g13169.t60 cds g13169.t60.CDS1 28317095 28317310
chr_1 g13169 g13169.t60 exon g13169.t60.exon4 28317377 28317502
chr_1 g13169 g13169.t60 cds g13169.t60.CDS2 28317377 28317502
chr_1 g13169 g13169.t60 exon g13169.t60.exon5 28317822 28317858
chr_1 g13169 g13169.t60 cds g13169.t60.CDS3 28317822 28317845
chr_1 g13169 g13169.t60 TTS g13169.t60 28317861 28317861

Sequences

>g13169.t60 Gene=g13169 Length=576
ATGTCTCTTACTTGGACTTTAATCGCTGGATTTTTGTATGCTGAAGTTGCTGTTGTTCTT
TTATTATCTTTAGTGCATCCAAATGGAATCGTTTCTTCAAATCAAGATTTCTGTCAGCTC
TCTCTCGGCAAGCACAGATTTACTTTTATTTGATGCTTGGTGTTTTGGTAATCTTTTTGC
TTGAGGCTATTAGAGAAATGCGTAAATACAGCAGCAGTGAAGAGGAAACTACTCTTAATT
TGGGAATGCAACATTCAATGAGACTCTTCCGTGCTCAACGCAACTTTTACATCTCTGGGT
TTGCCATTTTCTTGTCATTGGTCATTAGACGATTGATTATTTTAATCACAACACAAGCAT
CGTTAATTGCAAATTCTGAAGCAAGCATGAAACAAGCACAGTCCGCAACACAGGCTGCTC
GTCATTTAATGGCCGAAAAGAAAACTGATGGTGGTTCTGCTAACACTGCTAATAGTGATA
ATAAAGCTGATGATGATAAGGAAAAATTACAAAACAAGATTAAAGAATTGGAAGCTGAAA
GAAAAAAGAGAATTAAACAATAAAACTTGATAAAAA

>g13169.t60 Gene=g13169 Length=121
MRKYSSSEEETTLNLGMQHSMRLFRAQRNFYISGFAIFLSLVIRRLIILITTQASLIANS
EASMKQAQSATQAARHLMAEKKTDGGSANTANSDNKADDDKEKLQNKIKELEAERKKRIK
Q

Protein features from InterProScan

Transcript Database ID Name Start End E.value
7 g13169.t60 Coils Coil Coil 94 121 -
6 g13169.t60 MobiDBLite mobidb-lite consensus disorder prediction 65 121 -
5 g13169.t60 MobiDBLite mobidb-lite consensus disorder prediction 94 121 -
2 g13169.t60 PANTHER PTHR12701:SF50 LP10861P 1 116 1.3E-25
3 g13169.t60 PANTHER PTHR12701 BCR-ASSOCIATED PROTEIN, BAP 1 116 1.3E-25
1 g13169.t60 Pfam PF05529 Bap31/Bap29 transmembrane region 6 62 3.2E-17
8 g13169.t60 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 29 -
10 g13169.t60 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 30 50 -
9 g13169.t60 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 51 121 -
4 g13169.t60 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 29 48 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0006886 intracellular protein transport BP
GO:0005783 endoplasmic reticulum CC
GO:0016021 integral component of membrane CC

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed