Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g13169 g13169.t7 TSS g13169.t7 28316629 28316629
chr_1 g13169 g13169.t7 isoform g13169.t7 28316740 28317258
chr_1 g13169 g13169.t7 exon g13169.t7.exon1 28316740 28316883
chr_1 g13169 g13169.t7 exon g13169.t7.exon2 28316964 28317258
chr_1 g13169 g13169.t7 cds g13169.t7.CDS1 28317050 28317256
chr_1 g13169 g13169.t7 TTS g13169.t7 28317861 28317861

Sequences

>g13169.t7 Gene=g13169 Length=439
ATGTCTCTTACTTGGACTTTAATCGGTGCGTAAAAGTTTTTCTCGAAAATAAATTTATTT
TGAAAACATTCCCGTACATTCTAAAATTTACAGCTGGATTTTTGTATGCTGAAGTTGCTG
TTGTTCTTTTATTAGTATTGCCTGTCTTTAGTGCATCCAAATGGAATCGTTTCTTCAAAT
CAAGATTTCTGTCAGCTCTCTCTCGGCAAGCACAGATTTACTTTTATTTGATGCTTGGTG
TTTTGGTAATCTTTTTGCTTGAGGCTATTAGAGAAATGCGTAAATACAGCAGCAGTGAAG
AGGAAACTACTCTTAATTTGGGAATGCAACATTCAATGAGACTCTTCCGTGCTCAACGCA
ACTTTTACATCTCTGGGTTTGCCATTTTCTTGTCATTGGTCATTAGACGATTGATTATTT
TAATCACAACACAAGCATC

>g13169.t7 Gene=g13169 Length=69
MLGVLVIFLLEAIREMRKYSSSEEETTLNLGMQHSMRLFRAQRNFYISGFAIFLSLVIRR
LIILITTQA

Protein features from InterProScan

Transcript Database ID Name Start End E.value
2 g13169.t7 PANTHER PTHR12701:SF50 LP10861P 1 69 7.0E-21
3 g13169.t7 PANTHER PTHR12701 BCR-ASSOCIATED PROTEIN, BAP 1 69 7.0E-21
1 g13169.t7 Pfam PF05529 Bap31/Bap29 transmembrane region 1 68 8.7E-22
7 g13169.t7 Phobius SIGNAL_PEPTIDE Signal peptide region 1 22 -
8 g13169.t7 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 1 -
9 g13169.t7 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 2 10 -
11 g13169.t7 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 11 22 -
6 g13169.t7 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 23 45 -
10 g13169.t7 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 46 65 -
5 g13169.t7 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 66 69 -
4 g13169.t7 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 45 64 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

## Warning: Removed 1 row(s) containing missing values (geom_path).

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0006886 intracellular protein transport BP
GO:0005783 endoplasmic reticulum CC
GO:0016021 integral component of membrane CC

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed