| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13238 | g13238.t2 | isoform | g13238.t2 | 28733273 | 28734358 |
| chr_1 | g13238 | g13238.t2 | exon | g13238.t2.exon1 | 28733273 | 28733533 |
| chr_1 | g13238 | g13238.t2 | cds | g13238.t2.CDS1 | 28733273 | 28733533 |
| chr_1 | g13238 | g13238.t2 | exon | g13238.t2.exon2 | 28733592 | 28733647 |
| chr_1 | g13238 | g13238.t2 | cds | g13238.t2.CDS2 | 28733592 | 28733647 |
| chr_1 | g13238 | g13238.t2 | exon | g13238.t2.exon3 | 28733722 | 28733909 |
| chr_1 | g13238 | g13238.t2 | cds | g13238.t2.CDS3 | 28733722 | 28733909 |
| chr_1 | g13238 | g13238.t2 | exon | g13238.t2.exon4 | 28734270 | 28734358 |
| chr_1 | g13238 | g13238.t2 | cds | g13238.t2.CDS4 | 28734270 | 28734358 |
| chr_1 | g13238 | g13238.t2 | TSS | g13238.t2 | NA | NA |
| chr_1 | g13238 | g13238.t2 | TTS | g13238.t2 | NA | NA |
>g13238.t2 Gene=g13238 Length=594
ATGTTCGGAAGAAATAATAGTGAACCACTATGGAAAATTTTTAGAAAGCACCCTATAACA
AGAGGAATGGCATCCTATCTAGTCATATGGCCAACTGCAAATATTATACAACAGACATTA
TGTGAGAAGGATTTTGATTGGTGGAAGGTAGTACGATTTGGATTATATGGATGTTTTATC
ACAGCACCAAGTCTATATTGTTGGGTTAAACTTGCTACATTCATGTATCCAAATAATCAA
CTTCGTCTATGCATGGCTAAAGCACTAATCGAACAAATATCATACACACCACTTGCTATG
TGCACGTTTTTTTATAGTATGACATGGTTAGAAACTTTTTCAGCAGCTGAAGCTTTTCAA
GAAGTAAAAGTGAAATTTCCACCAACTTATTTTACTGCTATTACAATTTGGCCTCTAATT
GGCACCATAAACTTTGCATTCGTACCTGAAAGAAATCGCGTACTTTTTACCTCATGCTTT
TCATTGTTGTGGACGATATATTTAGCTCATATGAAAAACAGACAACGTGATAAGATGCTC
TTGGATAAAAATAATAAATCAAATGAGCTCACAACGAATACAAAAGACAAATAA
>g13238.t2 Gene=g13238 Length=197
MFGRNNSEPLWKIFRKHPITRGMASYLVIWPTANIIQQTLCEKDFDWWKVVRFGLYGCFI
TAPSLYCWVKLATFMYPNNQLRLCMAKALIEQISYTPLAMCTFFYSMTWLETFSAAEAFQ
EVKVKFPPTYFTAITIWPLIGTINFAFVPERNRVLFTSCFSLLWTIYLAHMKNRQRDKML
LDKNNKSNELTTNTKDK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g13238.t2 | PANTHER | PTHR11266 | PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 MPV17 | 12 | 178 | 1.0E-64 |
| 3 | g13238.t2 | PANTHER | PTHR11266:SF75 | IP10007P | 12 | 178 | 1.0E-64 |
| 1 | g13238.t2 | Pfam | PF04117 | Mpv17 / PMP22 family | 110 | 168 | 6.1E-17 |
| 12 | g13238.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 52 | - |
| 14 | g13238.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 76 | - |
| 9 | g13238.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 77 | 87 | - |
| 16 | g13238.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 88 | 110 | - |
| 11 | g13238.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 111 | 129 | - |
| 13 | g13238.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 130 | 147 | - |
| 8 | g13238.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 148 | 153 | - |
| 15 | g13238.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 154 | 171 | - |
| 10 | g13238.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 172 | 197 | - |
| 6 | g13238.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 72 | - |
| 5 | g13238.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 93 | 115 | - |
| 4 | g13238.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 130 | 147 | - |
| 7 | g13238.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 154 | 171 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed