General information for g13261.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g13261 is located on chr_1: 28850405..28850857 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13261 | g13261.t1 | isoform | g13261.t1 | 28850405 | 28850857 |
| chr_1 | g13261 | g13261.t1 | exon | g13261.t1.exon1 | 28850405 | 28850857 |
| chr_1 | g13261 | g13261.t1 | cds | g13261.t1.CDS1 | 28850405 | 28850857 |
| chr_1 | g13261 | g13261.t1 | TSS | g13261.t1 | NA | NA |
| chr_1 | g13261 | g13261.t1 | TTS | g13261.t1 | NA | NA |
Sequences
>g13261.t1 Gene=g13261 Length=453
ATGAAACTTAAAGTGTATGCACTTGTTTTCTTGTTGATTTCCTGTACTTTTGCGGATGAT
GAAACTACAGAATTAGCGAAACATAAGATAATTTCGGTAGATACTGAATATGTTCATATT
ATTTTAAAAAATCCTATTGACAACTGGAAAGATGGAGCACGAATTGTTCAAGCACTAGGT
GAAATGCTCAATCTGCAAAACTTTTTCACTCACATGCGTGTCGATAGGCATGAGGTGTCA
TTTAGAGTTGAACAAAATCCCGAGAAAAATACAGCTCTTGATGTGGCAAAATCTATCAAT
GACAGTCGTTTCAAAAACAATCTGTCGCGACGTCTTGGTGTTTTAGTGCTTCGTGCTGGT
GTTGGCGATAAAGTGAAAGACTATGAGAACGATATTAATGACAATCAAGAACTTTCAAGA
ACTTTTTTGGATTCAAATGGTATTCAAGATTAA
>g13261.t1 Gene=g13261 Length=150
MKLKVYALVFLLISCTFADDETTELAKHKIISVDTEYVHIILKNPIDNWKDGARIVQALG
EMLNLQNFFTHMRVDRHEVSFRVEQNPEKNTALDVAKSINDSRFKNNLSRRLGVLVLRAG
VGDKVKDYENDINDNQELSRTFLDSNGIQD
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g13261.t1 | Gene3D | G3DSA:3.30.70.2470 | - | 29 | 126 | 3.1E-14 |
| 3 | g13261.t1 | PANTHER | PTHR46106 | IA-2 PROTEIN TYROSINE PHOSPHATASE, ISOFORM C | 29 | 135 | 3.3E-24 |
| 4 | g13261.t1 | PANTHER | PTHR46106:SF4 | IA-2 PROTEIN TYROSINE PHOSPHATASE, ISOFORM C | 29 | 135 | 3.3E-24 |
| 2 | g13261.t1 | Pfam | PF11548 | Protein-tyrosine phosphatase receptor IA-2 | 35 | 124 | 4.9E-28 |
| 9 | g13261.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 18 | - |
| 10 | g13261.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 4 | - |
| 11 | g13261.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 5 | 13 | - |
| 12 | g13261.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 14 | 18 | - |
| 8 | g13261.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 19 | 150 | - |
| 7 | g13261.t1 | ProSiteProfiles | PS51257 | Prokaryotic membrane lipoprotein lipid attachment site profile. | 1 | 15 | 6.0 |
| 5 | g13261.t1 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 18 | - |
| 1 | g13261.t1 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM | 1 | 18 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0030141 | secretory granule | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed