General information for g13264.t2
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Thioredoxin domain-containing protein 5-like protein.
Parent gene
- The parent gene g13264 is located on chr_1: 28856522..28859179 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13264 | g13264.t2 | TSS | g13264.t2 | 28854926 | 28854926 |
| chr_1 | g13264 | g13264.t2 | isoform | g13264.t2 | 28855024 | 28855967 |
| chr_1 | g13264 | g13264.t2 | exon | g13264.t2.exon1 | 28855024 | 28855211 |
| chr_1 | g13264 | g13264.t2 | cds | g13264.t2.CDS1 | 28855024 | 28855211 |
| chr_1 | g13264 | g13264.t2 | exon | g13264.t2.exon2 | 28855584 | 28855967 |
| chr_1 | g13264 | g13264.t2 | cds | g13264.t2.CDS2 | 28855584 | 28855965 |
| chr_1 | g13264 | g13264.t2 | TTS | g13264.t2 | 28856971 | 28856971 |
Sequences
>g13264.t2 Gene=g13264 Length=572
ATGAAACTTAAAGTGCTTGCATTTATTTTCTTGTTGATTTCCTGCACTATTGCGGATGAA
GAAGATAATAAAATTGAGGCTGAAGAAGAACCAGAAAAAGACCATACATTAGTTTTGACA
GATGAAAATTTTGATGACACCATCAAATCCAGTGAAACAGCAATTTTTACAATGTTTTAT
GCACCATGGTGTGGACACTGTACAAGATTAAAGCCTACATGGTCACAATTAGCAGAAATG
CTTAATACACAAGATGAAAGTCGTGTGCGAATTGCAAAAGTTGATTGTACTGAAAATGCA
AAAACATGCAGTGATAACGAAATTACAAGCTATCCAACATTGAAATTTTTCAAAGCAAAT
GGTGAAGAGCCTGTGAAATATCGTTCAACTCGTGATCTTCCTTCACTTACTCAATTTATC
AACGATCAACTCGGAGCCTCAACAGAAGAAGAAGAAACAGGAAGTCAAGATGCAGTTCCA
GCTCCTCTCACTGGTCTCATTGAGCTTAATGAAAAGAATTTCCATGAGCTTACCTCAAAA
GGGAAATTCTTTGTCAAATTTTATGCACCATG
>g13264.t2 Gene=g13264 Length=190
MKLKVLAFIFLLISCTIADEEDNKIEAEEEPEKDHTLVLTDENFDDTIKSSETAIFTMFY
APWCGHCTRLKPTWSQLAEMLNTQDESRVRIAKVDCTENAKTCSDNEITSYPTLKFFKAN
GEEPVKYRSTRDLPSLTQFINDQLGASTEEEETGSQDAVPAPLTGLIELNEKNFHELTSK
GKFFVKFYAP
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g13264.t2 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 14 | 159 | 3.3E-40 |
| 2 | g13264.t2 | PANTHER | PTHR45672 | PROTEIN DISULFIDE-ISOMERASE C17H9.14C-RELATED | 19 | 190 | 1.1E-40 |
| 5 | g13264.t2 | PRINTS | PR00421 | Thioredoxin family signature | 55 | 63 | 3.0E-6 |
| 3 | g13264.t2 | PRINTS | PR00421 | Thioredoxin family signature | 63 | 72 | 3.0E-6 |
| 4 | g13264.t2 | PRINTS | PR00421 | Thioredoxin family signature | 107 | 118 | 3.0E-6 |
| 1 | g13264.t2 | Pfam | PF00085 | Thioredoxin | 36 | 141 | 3.2E-27 |
| 10 | g13264.t2 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 18 | - |
| 11 | g13264.t2 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 4 | - |
| 12 | g13264.t2 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 5 | 13 | - |
| 13 | g13264.t2 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 14 | 18 | - |
| 9 | g13264.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 19 | 190 | - |
| 15 | g13264.t2 | ProSitePatterns | PS00194 | Thioredoxin family active site. | 56 | 74 | - |
| 18 | g13264.t2 | ProSiteProfiles | PS51257 | Prokaryotic membrane lipoprotein lipid attachment site profile. | 1 | 15 | 6.0 |
| 17 | g13264.t2 | ProSiteProfiles | PS51352 | Thioredoxin domain profile. | 26 | 145 | 12.879 |
| 6 | g13264.t2 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 29 | 145 | 9.47E-35 |
| 7 | g13264.t2 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 18 | - |
| 14 | g13264.t2 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM | 1 | 18 | - |
| 16 | g13264.t2 | TIGRFAM | TIGR01126 | pdi_dom: protein disulfide-isomerase domain | 39 | 143 | 6.6E-33 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003756 | protein disulfide isomerase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
