| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13302 | g13302.t26 | isoform | g13302.t26 | 29013460 | 29015173 |
| chr_1 | g13302 | g13302.t26 | exon | g13302.t26.exon1 | 29013460 | 29013560 |
| chr_1 | g13302 | g13302.t26 | cds | g13302.t26.CDS1 | 29013462 | 29013560 |
| chr_1 | g13302 | g13302.t26 | exon | g13302.t26.exon2 | 29013625 | 29013682 |
| chr_1 | g13302 | g13302.t26 | cds | g13302.t26.CDS2 | 29013625 | 29013682 |
| chr_1 | g13302 | g13302.t26 | exon | g13302.t26.exon3 | 29015022 | 29015173 |
| chr_1 | g13302 | g13302.t26 | cds | g13302.t26.CDS3 | 29015022 | 29015173 |
| chr_1 | g13302 | g13302.t26 | TSS | g13302.t26 | 29015404 | 29015404 |
| chr_1 | g13302 | g13302.t26 | TTS | g13302.t26 | NA | NA |
>g13302.t26 Gene=g13302 Length=311
ATGACAAAGGAAAATGATCCAAAACATGAACCGGAAATAACTGTTACTGCAGCTGAGCAG
TCAGCACCTAAGAGCAAACTTATTGTTGTTTCCAATCGTTTACCATTTGTTCTTAAGAAG
GACATTAGTGGAAAATTATATCGTCAAGCAAGTGCCGGTGGATTAGTCACAGCAGTTGCT
CCTGTTGTTATTAAGGGAAAAGGACAATGGGTCGGCTGGCCAGGTATGCATCTTCCCAAA
GATTTTGATGACTTACAAATTCCCGAATCTGATCCAAACGATCAAACACCAACCGCTGGT
TTAAAATCAGA
>g13302.t26 Gene=g13302 Length=103
MTKENDPKHEPEITVTAAEQSAPKSKLIVVSNRLPFVLKKDISGKLYRQASAGGLVTAVA
PVVIKGKGQWVGWPGMHLPKDFDDLQIPESDPNDQTPTAGLKS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g13302.t26 | Gene3D | G3DSA:3.40.50.2000 | Glycogen Phosphorylase B; | 17 | 103 | 5.0E-13 |
| 2 | g13302.t26 | MobiDBLite | mobidb-lite | consensus disorder prediction | 82 | 103 | - |
| 3 | g13302.t26 | MobiDBLite | mobidb-lite | consensus disorder prediction | 89 | 103 | - |
| 1 | g13302.t26 | SUPERFAMILY | SSF53756 | UDP-Glycosyltransferase/glycogen phosphorylase | 25 | 85 | 1.0E-8 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed