General information for g13337.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g13337 is located on chr_1: 29367188..29367481 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13337 | g13337.t1 | isoform | g13337.t1 | 29367188 | 29367481 |
| chr_1 | g13337 | g13337.t1 | exon | g13337.t1.exon1 | 29367188 | 29367481 |
| chr_1 | g13337 | g13337.t1 | cds | g13337.t1.CDS1 | 29367188 | 29367481 |
| chr_1 | g13337 | g13337.t1 | TSS | g13337.t1 | NA | NA |
| chr_1 | g13337 | g13337.t1 | TTS | g13337.t1 | NA | NA |
Sequences
>g13337.t1 Gene=g13337 Length=294
ATGAATGAAGTTGTTAAACCAATTGCTGCTGGAAAATGTAAATTTCCAATTCCAACTGAA
TTAATCACTGTAATGCTTTTCATGGCTTTGTCACACTCGTTAAATCTTGGTGAATTAAAT
TATAATGTCAAAGAAGTTGGAAAAGTTTTCGTAGGAATTCCCAAGCCTGAATTACCACCA
TTTGAACTTTTATGTCTCGTTGCAATTGACTCAATTCCAATAAGCATCGTCAGTTACTCA
ATTGCAATGAAAATATACACAAATTTTTGCAAGAAAAGAATTTTATACAGTTAA
>g13337.t1 Gene=g13337 Length=97
MNEVVKPIAAGKCKFPIPTELITVMLFMALSHSLNLGELNYNVKEVGKVFVGIPKPELPP
FELLCLVAIDSIPISIVSYSIAMKIYTNFCKKRILYS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g13337.t1 | PANTHER | PTHR11814 | SULFATE TRANSPORTER | 1 | 93 | 7.7E-20 |
| 2 | g13337.t1 | PANTHER | PTHR11814:SF189 | FI18412P1 | 1 | 93 | 7.7E-20 |
| 3 | g13337.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 20 | - |
| 7 | g13337.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 21 | 41 | - |
| 5 | g13337.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 42 | 60 | - |
| 6 | g13337.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 61 | 82 | - |
| 4 | g13337.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 83 | 97 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0055085 | transmembrane transport | BP |
| GO:0008272 | sulfate transport | BP |
| GO:0008271 | secondary active sulfate transmembrane transporter activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed