| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13373 | g13373.t1 | TTS | g13373.t1 | 29584047 | 29584047 |
| chr_1 | g13373 | g13373.t1 | isoform | g13373.t1 | 29584238 | 29585403 |
| chr_1 | g13373 | g13373.t1 | exon | g13373.t1.exon1 | 29584238 | 29584314 |
| chr_1 | g13373 | g13373.t1 | cds | g13373.t1.CDS1 | 29584238 | 29584314 |
| chr_1 | g13373 | g13373.t1 | exon | g13373.t1.exon2 | 29584381 | 29584443 |
| chr_1 | g13373 | g13373.t1 | cds | g13373.t1.CDS2 | 29584381 | 29584443 |
| chr_1 | g13373 | g13373.t1 | exon | g13373.t1.exon3 | 29584742 | 29584811 |
| chr_1 | g13373 | g13373.t1 | cds | g13373.t1.CDS3 | 29584742 | 29584811 |
| chr_1 | g13373 | g13373.t1 | exon | g13373.t1.exon4 | 29585066 | 29585110 |
| chr_1 | g13373 | g13373.t1 | cds | g13373.t1.CDS4 | 29585066 | 29585110 |
| chr_1 | g13373 | g13373.t1 | exon | g13373.t1.exon5 | 29585389 | 29585403 |
| chr_1 | g13373 | g13373.t1 | cds | g13373.t1.CDS5 | 29585389 | 29585403 |
| chr_1 | g13373 | g13373.t1 | TSS | g13373.t1 | 29585493 | 29585493 |
>g13373.t1 Gene=g13373 Length=270
ATGGGCCTTAAGGAGGATTTTGACGCTGCTGCAGAGCAAGTAAAGAACTTGAAAGCAAAG
CCATCAGATCAAGATCTACTCGAACTTTATTCATTATTCAAACAAGCTACAGTTGGTGAT
AATAATACAGAAAAACCTGGTATGCTAGATTTTAAAGGCAAAGCCAAATGGGAAGCATGG
AACTCAAGAAAGGGAATGTCTGCTGATGATGCAATGACTAAGTATATAGAGAAAGTCAAT
TCACTCGTTGCATCGCTCGGTGTCAACTAG
>g13373.t1 Gene=g13373 Length=89
MGLKEDFDAAAEQVKNLKAKPSDQDLLELYSLFKQATVGDNNTEKPGMLDFKGKAKWEAW
NSRKGMSADDAMTKYIEKVNSLVASLGVN
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g13373.t1 | CDD | cd00435 | ACBP | 3 | 87 | 4.52056E-42 |
| 9 | g13373.t1 | Gene3D | G3DSA:1.20.80.10 | - | 1 | 88 | 6.8E-37 |
| 2 | g13373.t1 | PANTHER | PTHR23310:SF54 | ACYL-COA-BINDING PROTEIN | 4 | 87 | 1.8E-33 |
| 3 | g13373.t1 | PANTHER | PTHR23310 | ACYL-COA-BINDING PROTEIN, ACBP | 4 | 87 | 1.8E-33 |
| 4 | g13373.t1 | PRINTS | PR00689 | Acyl-coA-binding protein signature | 4 | 19 | 6.2E-29 |
| 7 | g13373.t1 | PRINTS | PR00689 | Acyl-coA-binding protein signature | 21 | 39 | 6.2E-29 |
| 6 | g13373.t1 | PRINTS | PR00689 | Acyl-coA-binding protein signature | 44 | 59 | 6.2E-29 |
| 5 | g13373.t1 | PRINTS | PR00689 | Acyl-coA-binding protein signature | 65 | 82 | 6.2E-29 |
| 1 | g13373.t1 | Pfam | PF00887 | Acyl CoA binding protein | 5 | 83 | 3.6E-31 |
| 11 | g13373.t1 | ProSitePatterns | PS00880 | Acyl-CoA-binding (ACB) domain signature. | 21 | 39 | - |
| 12 | g13373.t1 | ProSiteProfiles | PS51228 | Acyl-CoA-binding (ACB) domain profile. | 3 | 88 | 46.562 |
| 8 | g13373.t1 | SUPERFAMILY | SSF47027 | Acyl-CoA binding protein | 3 | 85 | 2.22E-32 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0000062 | fatty-acyl-CoA binding | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.