| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1344 | g1344.t1 | TSS | g1344.t1 | 9944628 | 9944628 |
| chr_3 | g1344 | g1344.t1 | isoform | g1344.t1 | 9944683 | 9945266 |
| chr_3 | g1344 | g1344.t1 | exon | g1344.t1.exon1 | 9944683 | 9945003 |
| chr_3 | g1344 | g1344.t1 | cds | g1344.t1.CDS1 | 9944683 | 9945003 |
| chr_3 | g1344 | g1344.t1 | exon | g1344.t1.exon2 | 9945063 | 9945266 |
| chr_3 | g1344 | g1344.t1 | cds | g1344.t1.CDS2 | 9945063 | 9945266 |
| chr_3 | g1344 | g1344.t1 | TTS | g1344.t1 | 9945972 | 9945972 |
>g1344.t1 Gene=g1344 Length=525
ATGGATCACGACCATAATCACGATATGTCAACAACAATGGCTACAGGTACAACAACAATG
CCAGATGGAGTTTGTATTCCTCGTATGGACATGTCATTACACTGGGGTACTTGTGAATGG
ATTTTAGTGAGAACATGGAAGGCAGATACAACAGGAAAATTTGTGTTCGCTGCAGTATTG
ATTTGTTTTGCTACAGTTGCTTATGAAGGATTAAAATTCTATCGTGAAATGCTTTTCTAT
CAAACAGCAAGAAATAAAGTGAAATTTACAAAACAAAACGATGGAACACTTGTGAAAGTT
CAAGAGAAAATGACAATTAAAGATCAACTCTTCAATTGGCCTCATATTTTACAAACATTT
CTTCATGGTCTTCAAATATTCATCTCATACATGCTAATGTTGATCATCATGTTATGCAAT
TTAAATTTAATAATAAGTATATGCGTCGGTGCTGCGGTTGGCTATTTTTTCTTTGCATGG
TTAAAAAAGTCAACTATAAATGATTTAAATGAGTGTTGTTATTAG
>g1344.t1 Gene=g1344 Length=174
MDHDHNHDMSTTMATGTTTMPDGVCIPRMDMSLHWGTCEWILVRTWKADTTGKFVFAAVL
ICFATVAYEGLKFYREMLFYQTARNKVKFTKQNDGTLVKVQEKMTIKDQLFNWPHILQTF
LHGLQIFISYMLMLIIMLCNLNLIISICVGAAVGYFFFAWLKKSTINDLNECCY
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g1344.t1 | PANTHER | PTHR12483:SF27 | COPPER TRANSPORTER 1A, ISOFORM C-RELATED | 2 | 168 | 3.8E-28 |
| 3 | g1344.t1 | PANTHER | PTHR12483 | SOLUTE CARRIER FAMILY 31 COPPER TRANSPORTERS | 2 | 168 | 3.8E-28 |
| 1 | g1344.t1 | Pfam | PF04145 | Ctr copper transporter family | 31 | 158 | 4.0E-23 |
| 10 | g1344.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 53 | - |
| 13 | g1344.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 71 | - |
| 7 | g1344.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 72 | 115 | - |
| 12 | g1344.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 116 | 137 | - |
| 9 | g1344.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 138 | 142 | - |
| 11 | g1344.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 143 | 161 | - |
| 8 | g1344.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 162 | 174 | - |
| 6 | g1344.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 71 | - |
| 5 | g1344.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 116 | 138 | - |
| 4 | g1344.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 143 | 161 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0035434 | copper ion transmembrane transport | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0005375 | copper ion transmembrane transporter activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed