| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13451 | g13451.t32 | TSS | g13451.t32 | 30216476 | 30216476 |
| chr_1 | g13451 | g13451.t32 | isoform | g13451.t32 | 30216639 | 30217230 |
| chr_1 | g13451 | g13451.t32 | exon | g13451.t32.exon1 | 30216639 | 30216697 |
| chr_1 | g13451 | g13451.t32 | cds | g13451.t32.CDS1 | 30216640 | 30216697 |
| chr_1 | g13451 | g13451.t32 | exon | g13451.t32.exon2 | 30216759 | 30216821 |
| chr_1 | g13451 | g13451.t32 | cds | g13451.t32.CDS2 | 30216759 | 30216821 |
| chr_1 | g13451 | g13451.t32 | exon | g13451.t32.exon3 | 30216878 | 30217023 |
| chr_1 | g13451 | g13451.t32 | cds | g13451.t32.CDS3 | 30216878 | 30217023 |
| chr_1 | g13451 | g13451.t32 | exon | g13451.t32.exon4 | 30217084 | 30217230 |
| chr_1 | g13451 | g13451.t32 | cds | g13451.t32.CDS4 | 30217084 | 30217230 |
| chr_1 | g13451 | g13451.t32 | TTS | g13451.t32 | 30217346 | 30217346 |
>g13451.t32 Gene=g13451 Length=415
AGACGTTGGTGATCAAGATTTGATAAGAAAAGCAGTTGAGGCGAGGAATTTTGCATACTG
TCCATATTCAAATTTTGCTGTGGGGAGTGCATTGAGAACTAACACTGGTGAAATTTTTAC
AGGATGTAATGTTGAGAATGTTGCCCATTCTCCTGGAGTTTGTGCCGAAAGAACAGCTAT
TGTAAAAGCTGTTAGTGAAGGATTTACAAAATTTGATGCAATTGCAGTAGTTGCATATTT
AGAAAATGATTTTTGCACACCATGTGGCGTATGCAGACAAGCTCTTTCGGAATTTGCATC
ACCGGATATTAAAGTGTTTGTTGCTAAACCAGTTGCTATTAGAGTATTGTGTACTTCAGT
TCAAGAACTTCTTCCATATCGTTTTTCTCCTGATAAATTGCAAAAACAATTGTAA
>g13451.t32 Gene=g13451 Length=137
DVGDQDLIRKAVEARNFAYCPYSNFAVGSALRTNTGEIFTGCNVENVAHSPGVCAERTAI
VKAVSEGFTKFDAIAVVAYLENDFCTPCGVCRQALSEFASPDIKVFVAKPVAIRVLCTSV
QELLPYRFSPDKLQKQL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g13451.t32 | CDD | cd01283 | cytidine_deaminase | 8 | 110 | 1.54965E-41 |
| 5 | g13451.t32 | Gene3D | G3DSA:3.40.140.10 | Cytidine Deaminase | 2 | 137 | 4.3E-50 |
| 2 | g13451.t32 | PANTHER | PTHR11644:SF24 | CYTIDINE DEAMINASE | 4 | 136 | 1.2E-44 |
| 3 | g13451.t32 | PANTHER | PTHR11644 | CYTIDINE DEAMINASE | 4 | 136 | 1.2E-44 |
| 1 | g13451.t32 | Pfam | PF00383 | Cytidine and deoxycytidylate deaminase zinc-binding region | 4 | 102 | 8.4E-16 |
| 7 | g13451.t32 | ProSitePatterns | PS00903 | Cytidine and deoxycytidylate deaminases zinc-binding region signature. | 54 | 95 | - |
| 8 | g13451.t32 | ProSiteProfiles | PS51747 | Cytidine and deoxycytidylate deaminases domain profile. | 2 | 131 | 28.814 |
| 4 | g13451.t32 | SUPERFAMILY | SSF53927 | Cytidine deaminase-like | 3 | 133 | 3.01E-44 |
| 9 | g13451.t32 | TIGRFAM | TIGR01354 | cyt_deam_tetra: cytidine deaminase | 6 | 132 | 1.6E-40 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016787 | hydrolase activity | MF |
| GO:0009972 | cytidine deamination | BP |
| GO:0004126 | cytidine deaminase activity | MF |
| GO:0008270 | zinc ion binding | MF |
| GO:0003824 | catalytic activity | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.