Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g13509 g13509.t3 isoform g13509.t3 30575253 30584299
chr_1 g13509 g13509.t3 exon g13509.t3.exon1 30575253 30575331
chr_1 g13509 g13509.t3 cds g13509.t3.CDS1 30575255 30575331
chr_1 g13509 g13509.t3 exon g13509.t3.exon2 30579764 30580020
chr_1 g13509 g13509.t3 cds g13509.t3.CDS2 30579764 30579983
chr_1 g13509 g13509.t3 exon g13509.t3.exon3 30584269 30584299
chr_1 g13509 g13509.t3 TTS g13509.t3 30584495 30584495
chr_1 g13509 g13509.t3 TSS g13509.t3 NA NA

Sequences

>g13509.t3 Gene=g13509 Length=367
CTATGTTGCTCCTTTCATTTCCAAAATCAATCGGATTAATCGGCTCTGTCCTTGCATTAC
GCTTGATTGCAACAACTGGAGTAATGGCAACTGAATTGAAGCAAGGAAATCCTGATCAAG
CAAAATCGGTCTATGAGTTTGTCGTTAATGATATCAAGGGCAATCCAATCAGCATGGAAA
AGTACCGTGGCCATCCATTGATCATTGTCAACGTTGCATCTAAATGTGGATATACCGAAA
AGCATTATGCTGAATTGAATGCACTCTACGATGAATATGCCGAATCAAAGGGTAAGTAAT
ATACTTGTAGAATTTTACTAATTTATCTGTGAATGTTTCATGAGTTATTTCAAAAGTTAA
CCTCACC

>g13509.t3 Gene=g13509 Length=98
MLLLSFPKSIGLIGSVLALRLIATTGVMATELKQGNPDQAKSVYEFVVNDIKGNPISMEK
YRGHPLIIVNVASKCGYTEKHYAELNALYDEYAESKGK

Protein features from InterProScan

Transcript Database ID Name Start End E.value
6 g13509.t3 Gene3D G3DSA:3.40.30.10 Glutaredoxin 29 97 3.1E-20
2 g13509.t3 PANTHER PTHR11592:SF121 GLUTATHIONE PEROXIDASE 26 97 1.8E-22
3 g13509.t3 PANTHER PTHR11592 GLUTATHIONE PEROXIDASE 26 97 1.8E-22
1 g13509.t3 Pfam PF00255 Glutathione peroxidase 43 94 1.1E-14
8 g13509.t3 Phobius SIGNAL_PEPTIDE Signal peptide region 1 29 -
9 g13509.t3 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 9 -
10 g13509.t3 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 10 21 -
11 g13509.t3 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 22 29 -
7 g13509.t3 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 30 98 -
12 g13509.t3 ProSitePatterns PS00460 Glutathione peroxidases active site. 63 78 -
13 g13509.t3 ProSiteProfiles PS51355 Glutathione peroxidase profile. 33 98 25.545
4 g13509.t3 SUPERFAMILY SSF52833 Thioredoxin-like 41 94 2.6E-16
5 g13509.t3 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM 1 29 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0006979 response to oxidative stress BP
GO:0004602 glutathione peroxidase activity MF
GO:0055114 NA NA

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values