General information for g13509.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g13509 is located on chr_1: 30583916..30584496 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13509 | g13509.t3 | isoform | g13509.t3 | 30575253 | 30584299 |
| chr_1 | g13509 | g13509.t3 | exon | g13509.t3.exon1 | 30575253 | 30575331 |
| chr_1 | g13509 | g13509.t3 | cds | g13509.t3.CDS1 | 30575255 | 30575331 |
| chr_1 | g13509 | g13509.t3 | exon | g13509.t3.exon2 | 30579764 | 30580020 |
| chr_1 | g13509 | g13509.t3 | cds | g13509.t3.CDS2 | 30579764 | 30579983 |
| chr_1 | g13509 | g13509.t3 | exon | g13509.t3.exon3 | 30584269 | 30584299 |
| chr_1 | g13509 | g13509.t3 | TTS | g13509.t3 | 30584495 | 30584495 |
| chr_1 | g13509 | g13509.t3 | TSS | g13509.t3 | NA | NA |
Sequences
>g13509.t3 Gene=g13509 Length=367
CTATGTTGCTCCTTTCATTTCCAAAATCAATCGGATTAATCGGCTCTGTCCTTGCATTAC
GCTTGATTGCAACAACTGGAGTAATGGCAACTGAATTGAAGCAAGGAAATCCTGATCAAG
CAAAATCGGTCTATGAGTTTGTCGTTAATGATATCAAGGGCAATCCAATCAGCATGGAAA
AGTACCGTGGCCATCCATTGATCATTGTCAACGTTGCATCTAAATGTGGATATACCGAAA
AGCATTATGCTGAATTGAATGCACTCTACGATGAATATGCCGAATCAAAGGGTAAGTAAT
ATACTTGTAGAATTTTACTAATTTATCTGTGAATGTTTCATGAGTTATTTCAAAAGTTAA
CCTCACC
>g13509.t3 Gene=g13509 Length=98
MLLLSFPKSIGLIGSVLALRLIATTGVMATELKQGNPDQAKSVYEFVVNDIKGNPISMEK
YRGHPLIIVNVASKCGYTEKHYAELNALYDEYAESKGK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g13509.t3 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 29 | 97 | 3.1E-20 |
| 2 | g13509.t3 | PANTHER | PTHR11592:SF121 | GLUTATHIONE PEROXIDASE | 26 | 97 | 1.8E-22 |
| 3 | g13509.t3 | PANTHER | PTHR11592 | GLUTATHIONE PEROXIDASE | 26 | 97 | 1.8E-22 |
| 1 | g13509.t3 | Pfam | PF00255 | Glutathione peroxidase | 43 | 94 | 1.1E-14 |
| 8 | g13509.t3 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 29 | - |
| 9 | g13509.t3 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 9 | - |
| 10 | g13509.t3 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 10 | 21 | - |
| 11 | g13509.t3 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 22 | 29 | - |
| 7 | g13509.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 30 | 98 | - |
| 12 | g13509.t3 | ProSitePatterns | PS00460 | Glutathione peroxidases active site. | 63 | 78 | - |
| 13 | g13509.t3 | ProSiteProfiles | PS51355 | Glutathione peroxidase profile. | 33 | 98 | 25.545 |
| 4 | g13509.t3 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 41 | 94 | 2.6E-16 |
| 5 | g13509.t3 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | 1 | 29 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006979 | response to oxidative stress | BP |
| GO:0004602 | glutathione peroxidase activity | MF |
| GO:0055114 | NA | NA |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
