General information for g13510.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Probable glutathione peroxidase 2.
Parent gene
- The parent gene g13510 is located on chr_1: 30585484..30585997 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13510 | g13510.t1 | TSS | g13510.t1 | 30583916 | 30583916 |
| chr_1 | g13510 | g13510.t1 | isoform | g13510.t1 | 30584851 | 30585792 |
| chr_1 | g13510 | g13510.t1 | exon | g13510.t1.exon1 | 30584851 | 30584866 |
| chr_1 | g13510 | g13510.t1 | cds | g13510.t1.CDS1 | 30584851 | 30584866 |
| chr_1 | g13510 | g13510.t1 | exon | g13510.t1.exon2 | 30585485 | 30585792 |
| chr_1 | g13510 | g13510.t1 | cds | g13510.t1.CDS2 | 30585485 | 30585792 |
| chr_1 | g13510 | g13510.t1 | TTS | g13510.t1 | 30586001 | 30586001 |
Sequences
>g13510.t1 Gene=g13510 Length=324
ATGTTACAAACAGGATGCTTGCGCATCCTTGCATTTCCATGTAATCAATTTAACAATCAA
GAGCCTGGCAATGCTGAAGAAATACAATGTTTCTTGAAGGATCGCAAAGTCAAATTTGAT
CTGTTTGAGAAAATTGATGTGAATGGGAAAGATGCACATCCATTGTGGAAATATTTGAAG
AAAGAGCAAGGTGGAACTCTTATTGATGCAATCAAGTGGAACTTTACTAAGTTCATTGTT
GATAAAGAAGGAAAACCAGTTGGTCGTCATTCACCAAATACTTCGCCAAAAGAGATGATC
AAAGATCTTGAGAAATATTTTTAA
>g13510.t1 Gene=g13510 Length=107
MLQTGCLRILAFPCNQFNNQEPGNAEEIQCFLKDRKVKFDLFEKIDVNGKDAHPLWKYLK
KEQGGTLIDAIKWNFTKFIVDKEGKPVGRHSPNTSPKEMIKDLEKYF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g13510.t1 | CDD | cd00340 | GSH_Peroxidase | 7 | 103 | 6.80468E-55 |
| 7 | g13510.t1 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 2 | 107 | 6.1E-42 |
| 2 | g13510.t1 | PANTHER | PTHR11592:SF121 | GLUTATHIONE PEROXIDASE | 6 | 107 | 1.6E-50 |
| 3 | g13510.t1 | PANTHER | PTHR11592 | GLUTATHIONE PEROXIDASE | 6 | 107 | 1.6E-50 |
| 8 | g13510.t1 | PIRSF | PIRSF000303 | Glutathion_perox | 3 | 107 | 3.8E-40 |
| 4 | g13510.t1 | PRINTS | PR01011 | Glutathione peroxidase family signature | 7 | 23 | 1.1E-9 |
| 5 | g13510.t1 | PRINTS | PR01011 | Glutathione peroxidase family signature | 71 | 80 | 1.1E-9 |
| 1 | g13510.t1 | Pfam | PF00255 | Glutathione peroxidase | 5 | 60 | 1.9E-19 |
| 10 | g13510.t1 | ProSitePatterns | PS00763 | Glutathione peroxidases signature 2. | 10 | 17 | - |
| 11 | g13510.t1 | ProSiteProfiles | PS51355 | Glutathione peroxidase profile. | 1 | 107 | 44.232 |
| 6 | g13510.t1 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 7 | 106 | 1.19E-33 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006979 | response to oxidative stress | BP |
| GO:0004602 | glutathione peroxidase activity | MF |
| GO:0055114 | NA | NA |
KEGG
Orthology
- This transcript has been annotated with K20207 (hydroperoxy fatty acid reductase)
Pathway
This gene does not belong to any pathways.
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
