Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Probable glutathione peroxidase 2.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g13511 g13511.t1 isoform g13511.t1 30587566 30588445
chr_1 g13511 g13511.t1 exon g13511.t1.exon1 30587566 30587653
chr_1 g13511 g13511.t1 cds g13511.t1.CDS1 30587566 30587653
chr_1 g13511 g13511.t1 exon g13511.t1.exon2 30588138 30588445
chr_1 g13511 g13511.t1 cds g13511.t1.CDS2 30588138 30588445
chr_1 g13511 g13511.t1 TTS g13511.t1 30588753 30588753
chr_1 g13511 g13511.t1 TSS g13511.t1 NA NA

Sequences

>g13511.t1 Gene=g13511 Length=396
ATGAAGGCAAAATTCTATCAATTTTCAATGAGCTGGAAATTGTGGAGTAACATGAATACA
CATCAACGATGCTGTGGAATGTCGATGAGTCTTCGCATTCTCGCATTTCCTTCGAATCAA
TTTTTGAATCAAGAGCCTGGTACCTCTGAAGAAATACAGAATTTCACTCAAGATCGCAAT
GTCAAGTTTGACCTATTCCAGAAGATTGATGTGAATGGCAAGAATGCACATCCATTATAT
CAATACTTGAAGAAGGAGCAAGGCGGTACATTGTTTGACGCTATTAAGTGGAATTTCACA
AAATTCATTATCGACAAGAATGGCAAGCCAGTCGAACGTCATTCACCAAACACCTCGCCT
AAAGAGATGCTCGAAAATTTGAAGAAATATTTCTAA

>g13511.t1 Gene=g13511 Length=131
MKAKFYQFSMSWKLWSNMNTHQRCCGMSMSLRILAFPSNQFLNQEPGTSEEIQNFTQDRN
VKFDLFQKIDVNGKNAHPLYQYLKKEQGGTLFDAIKWNFTKFIIDKNGKPVERHSPNTSP
KEMLENLKKYF

Protein features from InterProScan

Transcript Database ID Name Start End E.value
13 g13511.t1 CDD cd00340 GSH_Peroxidase 31 127 1.39318E-54
7 g13511.t1 Gene3D G3DSA:3.40.30.10 Glutaredoxin 7 131 2.3E-41
2 g13511.t1 PANTHER PTHR11592:SF121 GLUTATHIONE PEROXIDASE 28 131 1.1E-46
3 g13511.t1 PANTHER PTHR11592 GLUTATHIONE PEROXIDASE 28 131 1.1E-46
4 g13511.t1 PRINTS PR01011 Glutathione peroxidase family signature 31 47 1.9E-7
5 g13511.t1 PRINTS PR01011 Glutathione peroxidase family signature 95 104 1.9E-7
1 g13511.t1 Pfam PF00255 Glutathione peroxidase 28 84 6.0E-19
9 g13511.t1 Phobius SIGNAL_PEPTIDE Signal peptide region 1 35 -
10 g13511.t1 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 23 -
11 g13511.t1 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 24 31 -
12 g13511.t1 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 32 35 -
8 g13511.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 36 131 -
14 g13511.t1 ProSitePatterns PS00763 Glutathione peroxidases signature 2. 34 41 -
15 g13511.t1 ProSiteProfiles PS51355 Glutathione peroxidase profile. 1 131 41.287
6 g13511.t1 SUPERFAMILY SSF52833 Thioredoxin-like 30 130 4.32E-33

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0006979 response to oxidative stress BP
GO:0004602 glutathione peroxidase activity MF
GO:0055114 NA NA

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values