| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13527 | g13527.t2 | TSS | g13527.t2 | 30721237 | 30721237 |
| chr_1 | g13527 | g13527.t2 | isoform | g13527.t2 | 30721359 | 30721732 |
| chr_1 | g13527 | g13527.t2 | exon | g13527.t2.exon1 | 30721359 | 30721660 |
| chr_1 | g13527 | g13527.t2 | cds | g13527.t2.CDS1 | 30721359 | 30721660 |
| chr_1 | g13527 | g13527.t2 | exon | g13527.t2.exon2 | 30721730 | 30721732 |
| chr_1 | g13527 | g13527.t2 | cds | g13527.t2.CDS2 | 30721730 | 30721730 |
| chr_1 | g13527 | g13527.t2 | TTS | g13527.t2 | NA | NA |
>g13527.t2 Gene=g13527 Length=305
ATGGGACAGCATGTTTCGAAAACCGATTTTGAATGGTCGTATGACGATGAGCCGCATAAA
ACAAGAAGAACTGAAATTTTAAAGAAATATCCAGAGATTAAACAATTATTTGGATGTGAT
CCTAATTTTAAATATGTTTGCACTGCAATGGTTCTTACTCAAATAGCTTCACTGTACTTT
TTGCAAGATAAATCATGGACATTTCTATTCATTGCGGCTTATTGTTTTGGTGGAGTTTTA
AACCATAGTTTGAGTCTAGCTGTTCATGAAATTTCACACAATTTAAGTTTCGGTCATTCG
CGACC
>g13527.t2 Gene=g13527 Length=101
MGQHVSKTDFEWSYDDEPHKTRRTEILKKYPEIKQLFGCDPNFKYVCTAMVLTQIASLYF
LQDKSWTFLFIAAYCFGGVLNHSLSLAVHEISHNLSFGHSR
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g13527.t2 | PANTHER | PTHR12879 | SPHINGOLIPID DELTA 4 DESATURASE/C-4 HYDROXYLASE PROTEIN DES2 | 1 | 101 | 8.3E-33 |
| 3 | g13527.t2 | PANTHER | PTHR12879:SF2 | SPHINGOLIPID DELTA(4)-DESATURASE DES1 | 1 | 101 | 8.3E-33 |
| 1 | g13527.t2 | Pfam | PF08557 | Sphingolipid Delta4-desaturase (DES) | 6 | 42 | 4.8E-21 |
| 8 | g13527.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 42 | - |
| 9 | g13527.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 43 | 61 | - |
| 6 | g13527.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 62 | 67 | - |
| 10 | g13527.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 68 | 88 | - |
| 7 | g13527.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 89 | 101 | - |
| 5 | g13527.t2 | SMART | SM01269 | Lipid_DES_2 | 5 | 43 | 5.8E-21 |
| 4 | g13527.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 66 | 88 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0042284 | sphingolipid delta-4 desaturase activity | MF |
| GO:0030148 | sphingolipid biosynthetic process | BP |
| GO:0016021 | integral component of membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed