General information for g13583.t14
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
Parent gene
- The parent gene g13583 is located on chr_1: 31052241..31053399 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13583 | g13583.t14 | isoform | g13583.t14 | 31052241 | 31053399 |
| chr_1 | g13583 | g13583.t14 | exon | g13583.t14.exon1 | 31052241 | 31052244 |
| chr_1 | g13583 | g13583.t14 | cds | g13583.t14.CDS1 | 31052242 | 31052244 |
| chr_1 | g13583 | g13583.t14 | exon | g13583.t14.exon2 | 31052324 | 31052487 |
| chr_1 | g13583 | g13583.t14 | cds | g13583.t14.CDS2 | 31052324 | 31052487 |
| chr_1 | g13583 | g13583.t14 | exon | g13583.t14.exon3 | 31052551 | 31052676 |
| chr_1 | g13583 | g13583.t14 | cds | g13583.t14.CDS3 | 31052551 | 31052676 |
| chr_1 | g13583 | g13583.t14 | exon | g13583.t14.exon4 | 31053345 | 31053399 |
| chr_1 | g13583 | g13583.t14 | cds | g13583.t14.CDS4 | 31053345 | 31053399 |
| chr_1 | g13583 | g13583.t14 | TSS | g13583.t14 | 31053880 | 31053880 |
| chr_1 | g13583 | g13583.t14 | TTS | g13583.t14 | NA | NA |
Sequences
>g13583.t14 Gene=g13583 Length=349
ATGGACATGCAGCTAGGTTGGAAATTTTTACACAAAGAAACATTCATTCATACAGGTGAT
ACTACGAATTTCATAAATGTGCCCCACGTGATTGCTATGGTTGGCCTACCTGCTCGAGGA
AAGACATATATTGCAAAAAAGTTGTCGAGATATTTAAATTGGATCGGTATCAACACTAGA
GTCTTTAATTTAGGCGAGTATCGTCGTAACGTAACACAAGCATATAGAAATCATGATTTC
TTTCGACCTGATAATGACATAGCTATGCAGATTAGAACAAGTTGTGCAAAGCACGCGCTA
GATGACGTTGTGCAATGGCTTGAAACGGGAGGAGGAGAAGTTGCAGTTT
>g13583.t14 Gene=g13583 Length=116
MDMQLGWKFLHKETFIHTGDTTNFINVPHVIAMVGLPARGKTYIAKKLSRYLNWIGINTR
VFNLGEYRRNVTQAYRNHDFFRPDNDIAMQIRTSCAKHALDDVVQWLETGGGEVAV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g13583.t14 | Gene3D | G3DSA:3.40.50.300 | - | 27 | 116 | 0 |
| 2 | g13583.t14 | PANTHER | PTHR10606 | 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE | 17 | 116 | 0 |
| 5 | g13583.t14 | PIRSF | PIRSF000709 | 6PFK_fruc_bisph_Ptase | 9 | 116 | 0 |
| 1 | g13583.t14 | Pfam | PF01591 | 6-phosphofructo-2-kinase | 22 | 116 | 0 |
| 3 | g13583.t14 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 28 | 115 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006003 | fructose 2,6-bisphosphate metabolic process | BP |
| GO:0005524 | ATP binding | MF |
| GO:0006000 | fructose metabolic process | BP |
| GO:0003824 | catalytic activity | MF |
| GO:0003873 | 6-phosphofructo-2-kinase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
