| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13703 | g13703.t2 | isoform | g13703.t2 | 31851779 | 31861263 |
| chr_1 | g13703 | g13703.t2 | exon | g13703.t2.exon1 | 31851779 | 31851947 |
| chr_1 | g13703 | g13703.t2 | cds | g13703.t2.CDS1 | 31851779 | 31851947 |
| chr_1 | g13703 | g13703.t2 | exon | g13703.t2.exon2 | 31861097 | 31861263 |
| chr_1 | g13703 | g13703.t2 | cds | g13703.t2.CDS2 | 31861097 | 31861263 |
| chr_1 | g13703 | g13703.t2 | TSS | g13703.t2 | NA | NA |
| chr_1 | g13703 | g13703.t2 | TTS | g13703.t2 | NA | NA |
>g13703.t2 Gene=g13703 Length=336
ATGGCGGGCTTTCTTAAAACAACTGATCTCGGTGCACATCCGCACAGCTATGGAGCGCCA
CATCATCCTCATCACAGCCACGGTCCACCATTGCCACCTGGAATGCCAATGACAATGACA
CCATTTGGATTACCACATGGTCTCGACGCTGTTGGCTTTCCACATCAAGGCGTAAATCCA
AGAAAGCAACGCAGAGAGCGAACAACATTTACAAGAGCACAATTAGATGTGCTTGAATCA
CTTTTTGGCAAAACTAGATATCCTGATATATTTATGCGCGAGGAAGTTGCACTTAAAATC
AATTTGCCAGAATCAAGAGTTCAGTATGTTCATTAA
>g13703.t2 Gene=g13703 Length=111
MAGFLKTTDLGAHPHSYGAPHHPHHSHGPPLPPGMPMTMTPFGLPHGLDAVGFPHQGVNP
RKQRRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQYVH
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g13703.t2 | CDD | cd00086 | homeodomain | 64 | 108 | 2.1076E-14 |
| 5 | g13703.t2 | Gene3D | G3DSA:1.10.10.60 | - | 54 | 110 | 3.8E-18 |
| 8 | g13703.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 34 | - |
| 2 | g13703.t2 | PANTHER | PTHR45793 | HOMEOBOX PROTEIN | 7 | 108 | 2.5E-42 |
| 3 | g13703.t2 | PANTHER | PTHR45793:SF5 | HOMEOTIC PROTEIN OCELLILESS | 7 | 108 | 2.5E-42 |
| 1 | g13703.t2 | Pfam | PF00046 | Homeodomain | 64 | 109 | 3.9E-13 |
| 9 | g13703.t2 | ProSiteProfiles | PS50071 | ‘Homeobox’ domain profile. | 61 | 111 | 11.062 |
| 7 | g13703.t2 | SMART | SM00389 | HOX_1 | 63 | 111 | 2.8E-4 |
| 4 | g13703.t2 | SUPERFAMILY | SSF46689 | Homeodomain-like | 41 | 109 | 3.25E-15 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed