| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13703 | g13703.t3 | isoform | g13703.t3 | 31851779 | 31861263 |
| chr_1 | g13703 | g13703.t3 | exon | g13703.t3.exon1 | 31851779 | 31851956 |
| chr_1 | g13703 | g13703.t3 | cds | g13703.t3.CDS1 | 31851779 | 31851956 |
| chr_1 | g13703 | g13703.t3 | exon | g13703.t3.exon2 | 31861097 | 31861263 |
| chr_1 | g13703 | g13703.t3 | cds | g13703.t3.CDS2 | 31861097 | 31861263 |
| chr_1 | g13703 | g13703.t3 | TSS | g13703.t3 | NA | NA |
| chr_1 | g13703 | g13703.t3 | TTS | g13703.t3 | NA | NA |
>g13703.t3 Gene=g13703 Length=345
ATGGCGGGCTTTCTTAAAACAACTGATCTCGGTGCACATCCGCACAGCTATGGAGCGCCA
CATCATCCTCATCACAGCCACGGTCCACCATTGCCACCTGGAATGCCAATGACAATGACA
CCATTTGGATTACCACATGGTCTCGACGCTGTTGGCTTTCCACATCAAGGTATGTGGGGC
GTAAATCCAAGAAAGCAACGCAGAGAGCGAACAACATTTACAAGAGCACAATTAGATGTG
CTTGAATCACTTTTTGGCAAAACTAGATATCCTGATATATTTATGCGCGAGGAAGTTGCA
CTTAAAATCAATTTGCCAGAATCAAGAGTTCAGTATGTTCATTAA
>g13703.t3 Gene=g13703 Length=114
MAGFLKTTDLGAHPHSYGAPHHPHHSHGPPLPPGMPMTMTPFGLPHGLDAVGFPHQGMWG
VNPRKQRRERTTFTRAQLDVLESLFGKTRYPDIFMREEVALKINLPESRVQYVH
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g13703.t3 | CDD | cd00086 | homeodomain | 67 | 111 | 2.08021E-14 |
| 5 | g13703.t3 | Gene3D | G3DSA:1.10.10.60 | - | 60 | 114 | 4.3E-18 |
| 8 | g13703.t3 | MobiDBLite | mobidb-lite | consensus disorder prediction | 15 | 34 | - |
| 2 | g13703.t3 | PANTHER | PTHR45793 | HOMEOBOX PROTEIN | 7 | 111 | 3.1E-43 |
| 3 | g13703.t3 | PANTHER | PTHR45793:SF5 | HOMEOTIC PROTEIN OCELLILESS | 7 | 111 | 3.1E-43 |
| 1 | g13703.t3 | Pfam | PF00046 | Homeodomain | 67 | 112 | 4.1E-13 |
| 9 | g13703.t3 | ProSiteProfiles | PS50071 | ‘Homeobox’ domain profile. | 64 | 114 | 11.062 |
| 7 | g13703.t3 | SMART | SM00389 | HOX_1 | 66 | 114 | 2.8E-4 |
| 4 | g13703.t3 | SUPERFAMILY | SSF46689 | Homeodomain-like | 51 | 112 | 3.29E-15 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed