General information for g13718.t10
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Disks large 1 tumor suppressor protein.
Parent gene
- The parent gene g13718 is located on chr_1: 32025389..32026087 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13718 | g13718.t10 | TSS | g13718.t10 | 32012596 | 32012596 |
| chr_1 | g13718 | g13718.t10 | isoform | g13718.t10 | 32013125 | 32016865 |
| chr_1 | g13718 | g13718.t10 | exon | g13718.t10.exon1 | 32013125 | 32013211 |
| chr_1 | g13718 | g13718.t10 | cds | g13718.t10.CDS1 | 32013125 | 32013211 |
| chr_1 | g13718 | g13718.t10 | exon | g13718.t10.exon2 | 32016441 | 32016464 |
| chr_1 | g13718 | g13718.t10 | cds | g13718.t10.CDS2 | 32016441 | 32016464 |
| chr_1 | g13718 | g13718.t10 | exon | g13718.t10.exon3 | 32016531 | 32016592 |
| chr_1 | g13718 | g13718.t10 | cds | g13718.t10.CDS3 | 32016531 | 32016592 |
| chr_1 | g13718 | g13718.t10 | exon | g13718.t10.exon4 | 32016657 | 32016865 |
| chr_1 | g13718 | g13718.t10 | cds | g13718.t10.CDS4 | 32016657 | 32016864 |
| chr_1 | g13718 | g13718.t10 | TTS | g13718.t10 | NA | NA |
Sequences
>g13718.t10 Gene=g13718 Length=382
ATGACGACACGAAAGAAGAATAAAAATCAACAGAAGGAGACTGGTGGATTTATAAAAAAG
GTTTCATCATTATTTAATTTAGATACGGCATCAGCAGGAACGGATGCAAAAGTCAATGGA
GATGATCAATGGGTGCATGAGGAAATCGCTTTATCACGAGGCTCAAGTGGACTCGGATTC
AGTATAGCAGGAGGCACTGATAATCCACACATCGGGACTGATACATCAATTTATATCACA
AAAATAATTCCCGGTGGAGCCGCATATTCAGACGGTCGTATTCAAGTAAATGACATTATT
GTATCAGTCAATGATGTATCAGTTGTTGATGTTACGCATGCACTTGCTGTTGAAGCGCTT
AAAAGTGCTGGTGATAGAGTCA
>g13718.t10 Gene=g13718 Length=127
MTTRKKNKNQQKETGGFIKKVSSLFNLDTASAGTDAKVNGDDQWVHEEIALSRGSSGLGF
SIAGGTDNPHIGTDTSIYITKIIPGGAAYSDGRIQVNDIIVSVNDVSVVDVTHALAVEAL
KSAGDRV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g13718.t10 | CDD | cd00992 | PDZ_signaling | 48 | 127 | 0.000 |
| 6 | g13718.t10 | Gene3D | G3DSA:2.30.42.10 | - | 36 | 127 | 0.000 |
| 2 | g13718.t10 | PANTHER | PTHR23119 | DISCS LARGE | 22 | 127 | 0.000 |
| 3 | g13718.t10 | PANTHER | PTHR23119:SF51 | DISKS LARGE 1 TUMOR SUPPRESSOR PROTEIN | 22 | 127 | 0.000 |
| 1 | g13718.t10 | Pfam | PF00595 | PDZ domain | 49 | 126 | 0.000 |
| 7 | g13718.t10 | ProSiteProfiles | PS50106 | PDZ domain profile. | 48 | 127 | 21.471 |
| 5 | g13718.t10 | SMART | SM00228 | pdz_new | 56 | 127 | 0.000 |
| 4 | g13718.t10 | SUPERFAMILY | SSF50156 | PDZ domain-like | 40 | 127 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed