| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13753 | g13753.t12 | TTS | g13753.t12 | 32244371 | 32244371 |
| chr_1 | g13753 | g13753.t12 | isoform | g13753.t12 | 32245035 | 32245453 |
| chr_1 | g13753 | g13753.t12 | exon | g13753.t12.exon1 | 32245035 | 32245311 |
| chr_1 | g13753 | g13753.t12 | cds | g13753.t12.CDS1 | 32245035 | 32245311 |
| chr_1 | g13753 | g13753.t12 | exon | g13753.t12.exon2 | 32245380 | 32245453 |
| chr_1 | g13753 | g13753.t12 | cds | g13753.t12.CDS2 | 32245380 | 32245453 |
| chr_1 | g13753 | g13753.t12 | TSS | g13753.t12 | 32245673 | 32245673 |
>g13753.t12 Gene=g13753 Length=351
ATGGCTAACGTTTTAATTGCTGGGTACAATGAAATACCGATTGTTACAAGAATATATACA
ACAGCTTGTGTTTGCACAACATTTGCCGTTCATTTGGATTTAGTATCACCTTTTCAGTTA
TATTTCAATCCAAATTTAATTATGCAAGGACAAATTTGGCGACTCGTCACCACTTTTCTG
TTTTTCGGCACAATAGGATTTTCTTTTCTCTTTAATATGATTTTCACATATCGGTATTGC
CGTATGTTAGAAGAAGGATCATTTAGAGGAAAAACAGCAGATTTTATTATGATGTTCTTT
TTTGGAGCAGTTTTCATGATATTTTTTGCCTTCTTTATTAACCTTTTGTTC
>g13753.t12 Gene=g13753 Length=117
MANVLIAGYNEIPIVTRIYTTACVCTTFAVHLDLVSPFQLYFNPNLIMQGQIWRLVTTFL
FFGTIGFSFLFNMIFTYRYCRMLEEGSFRGKTADFIMMFFFGAVFMIFFAFFINLLF
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g13753.t12 | PANTHER | PTHR11009:SF4 | DERLIN-3 | 4 | 117 | 1.7E-43 |
| 3 | g13753.t12 | PANTHER | PTHR11009 | DER1-LIKE PROTEIN, DERLIN | 4 | 117 | 1.7E-43 |
| 1 | g13753.t12 | Pfam | PF04511 | Der1-like family | 12 | 117 | 2.1E-35 |
| 8 | g13753.t12 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 13 | g13753.t12 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 32 | - |
| 11 | g13753.t12 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 33 | 51 | - |
| 14 | g13753.t12 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 52 | 75 | - |
| 9 | g13753.t12 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 76 | 94 | - |
| 12 | g13753.t12 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 95 | 116 | - |
| 10 | g13753.t12 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 117 | 117 | - |
| 7 | g13753.t12 | SUPERFAMILY | SSF144091 | Rhomboid-like | 10 | 114 | 1.2E-12 |
| 6 | g13753.t12 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 13 | 35 | - |
| 5 | g13753.t12 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 50 | 72 | - |
| 4 | g13753.t12 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 93 | 115 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed