Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Derlin-2.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g13753 g13753.t12 TTS g13753.t12 32244371 32244371
chr_1 g13753 g13753.t12 isoform g13753.t12 32245035 32245453
chr_1 g13753 g13753.t12 exon g13753.t12.exon1 32245035 32245311
chr_1 g13753 g13753.t12 cds g13753.t12.CDS1 32245035 32245311
chr_1 g13753 g13753.t12 exon g13753.t12.exon2 32245380 32245453
chr_1 g13753 g13753.t12 cds g13753.t12.CDS2 32245380 32245453
chr_1 g13753 g13753.t12 TSS g13753.t12 32245673 32245673

Sequences

>g13753.t12 Gene=g13753 Length=351
ATGGCTAACGTTTTAATTGCTGGGTACAATGAAATACCGATTGTTACAAGAATATATACA
ACAGCTTGTGTTTGCACAACATTTGCCGTTCATTTGGATTTAGTATCACCTTTTCAGTTA
TATTTCAATCCAAATTTAATTATGCAAGGACAAATTTGGCGACTCGTCACCACTTTTCTG
TTTTTCGGCACAATAGGATTTTCTTTTCTCTTTAATATGATTTTCACATATCGGTATTGC
CGTATGTTAGAAGAAGGATCATTTAGAGGAAAAACAGCAGATTTTATTATGATGTTCTTT
TTTGGAGCAGTTTTCATGATATTTTTTGCCTTCTTTATTAACCTTTTGTTC

>g13753.t12 Gene=g13753 Length=117
MANVLIAGYNEIPIVTRIYTTACVCTTFAVHLDLVSPFQLYFNPNLIMQGQIWRLVTTFL
FFGTIGFSFLFNMIFTYRYCRMLEEGSFRGKTADFIMMFFFGAVFMIFFAFFINLLF

Protein features from InterProScan

Transcript Database ID Name Start End E.value
2 g13753.t12 PANTHER PTHR11009:SF4 DERLIN-3 4 117 1.7E-43
3 g13753.t12 PANTHER PTHR11009 DER1-LIKE PROTEIN, DERLIN 4 117 1.7E-43
1 g13753.t12 Pfam PF04511 Der1-like family 12 117 2.1E-35
8 g13753.t12 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 11 -
13 g13753.t12 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 12 32 -
11 g13753.t12 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 33 51 -
14 g13753.t12 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 52 75 -
9 g13753.t12 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 76 94 -
12 g13753.t12 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 95 116 -
10 g13753.t12 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 117 117 -
7 g13753.t12 SUPERFAMILY SSF144091 Rhomboid-like 10 114 1.2E-12
6 g13753.t12 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 13 35 -
5 g13753.t12 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 50 72 -
4 g13753.t12 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 93 115 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed