General information for g13857.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g13857 is located on chr_1: 32864604..32866817 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13857 | g13857.t3 | TSS | g13857.t3 | 32864176 | 32864176 |
| chr_1 | g13857 | g13857.t3 | isoform | g13857.t3 | 32864251 | 32864943 |
| chr_1 | g13857 | g13857.t3 | exon | g13857.t3.exon1 | 32864251 | 32864329 |
| chr_1 | g13857 | g13857.t3 | cds | g13857.t3.CDS1 | 32864251 | 32864329 |
| chr_1 | g13857 | g13857.t3 | exon | g13857.t3.exon2 | 32864604 | 32864781 |
| chr_1 | g13857 | g13857.t3 | cds | g13857.t3.CDS2 | 32864604 | 32864781 |
| chr_1 | g13857 | g13857.t3 | exon | g13857.t3.exon3 | 32864842 | 32864943 |
| chr_1 | g13857 | g13857.t3 | cds | g13857.t3.CDS3 | 32864842 | 32864923 |
| chr_1 | g13857 | g13857.t3 | TTS | g13857.t3 | 32865150 | 32865150 |
Sequences
>g13857.t3 Gene=g13857 Length=359
ATGGCGTCTTTGACTGGTCGCATTGTGCTCGCAGCAGCTCGTAGAAATGTACAATACACT
CCAGTTCGTTTCTGCAAAATGATGAACGATCCATTGGAACACGCAACTGGTCTTGAAAAA
CGCGAGTTGCTTGCTAAAGCTGCCGGCAATGATAATCCATTCGACATGAAAGTATTTAAA
CGCGGTCCAGGCACTAAAGAAAACCCAAATTTAATTCCATCAGCTTTCGATGCTCGTTTG
GTCGGTTGTATATGTAAGAAGAACAGACATACGTTAATTGGATGTGGCTCTATCAAGGAC
ATCCAAAGAGATGCGAATGTGGTCACTGGTTCAAATTAGTCGAAAAGGCTCCAGTATAA
>g13857.t3 Gene=g13857 Length=112
MASLTGRIVLAAARRNVQYTPVRFCKMMNDPLEHATGLEKRELLAKAAGNDNPFDMKVFK
RGPGTKENPNLIPSAFDARLVGCICKKNRHTLIGCGSIKDIQRDANVVTGSN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g13857.t3 | CDD | cd00924 | Cyt_c_Oxidase_Vb | 24 | 93 | 0.000 |
| 3 | g13857.t3 | Gene3D | G3DSA:2.60.11.10 | Cytochrome C Oxidase | 26 | 97 | 0.000 |
| 1 | g13857.t3 | Pfam | PF01215 | Cytochrome c oxidase subunit Vb | 32 | 93 | 0.000 |
| 4 | g13857.t3 | ProSiteProfiles | PS51359 | Cytochrome c oxidase subunit Vb, zinc binding domain profile. | 23 | 112 | 14.014 |
| 2 | g13857.t3 | SUPERFAMILY | SSF57802 | Rubredoxin-like | 25 | 93 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005740 | mitochondrial envelope | CC |
| GO:0004129 | cytochrome-c oxidase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed