| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g13857 | g13857.t8 | TSS | g13857.t8 | 32864176 | 32864176 |
| chr_1 | g13857 | g13857.t8 | isoform | g13857.t8 | 32864251 | 32864943 |
| chr_1 | g13857 | g13857.t8 | exon | g13857.t8.exon1 | 32864251 | 32864333 |
| chr_1 | g13857 | g13857.t8 | cds | g13857.t8.CDS1 | 32864297 | 32864333 |
| chr_1 | g13857 | g13857.t8 | exon | g13857.t8.exon2 | 32864604 | 32864771 |
| chr_1 | g13857 | g13857.t8 | cds | g13857.t8.CDS2 | 32864604 | 32864771 |
| chr_1 | g13857 | g13857.t8 | exon | g13857.t8.exon3 | 32864837 | 32864943 |
| chr_1 | g13857 | g13857.t8 | cds | g13857.t8.CDS3 | 32864837 | 32864943 |
| chr_1 | g13857 | g13857.t8 | TTS | g13857.t8 | 32865150 | 32865150 |
>g13857.t8 Gene=g13857 Length=358
ATGGCGTCTTTGACTGGTCGCATTGTGCTCGCAGCAGCTCGTAGAAATGTACAATACACT
CCAGTTCGTTTCTGCAAAAGTGATGATGAACGATCCATTGGAACACGCAACTGGTCTTGA
AAAACGCGAGTTGCTTGCTAAAGCTGCCGGCAATGATAATCCATTCGACATGAAAGTATT
TAAACGCGGTCCAGGCACTAAAGAAAACCCAAATTTAATTCCATCAGCTTTCGATGCTCG
TTTGGTCGGTTGTGAGGAAGAACAGACATACGTTAATTGGATGTGGCTCTATCAAGGACA
TCCAAAGAGATGCGAATGTGGTCACTGGTTCAAATTAGTCGAAAAGGCTCCAGTATAA
>g13857.t8 Gene=g13857 Length=103
MYNTLQFVSAKVMMNDPLEHATGLEKRELLAKAAGNDNPFDMKVFKRGPGTKENPNLIPS
AFDARLVGCEEEQTYVNWMWLYQGHPKRCECGHWFKLVEKAPV
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g13857.t8 | CDD | cd00924 | Cyt_c_Oxidase_Vb | 9 | 103 | 0.000 |
| 5 | g13857.t8 | Gene3D | G3DSA:2.60.11.10 | Cytochrome C Oxidase | 11 | 102 | 0.000 |
| 2 | g13857.t8 | PANTHER | PTHR10122 | CYTOCHROME C OXIDASE SUBUNIT 5B, MITOCHONDRIAL | 13 | 97 | 0.000 |
| 3 | g13857.t8 | PANTHER | PTHR10122:SF0 | CYTOCHROME C OXIDASE SUBUNIT 5B, MITOCHONDRIAL | 13 | 97 | 0.000 |
| 1 | g13857.t8 | Pfam | PF01215 | Cytochrome c oxidase subunit Vb | 17 | 98 | 0.000 |
| 6 | g13857.t8 | ProSiteProfiles | PS51359 | Cytochrome c oxidase subunit Vb, zinc binding domain profile. | 8 | 103 | 21.398 |
| 4 | g13857.t8 | SUPERFAMILY | SSF57802 | Rubredoxin-like | 13 | 99 | 0.000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005740 | mitochondrial envelope | CC |
| GO:0004129 | cytochrome-c oxidase activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed