General information for g1405.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Acyl-CoA desaturase 3.
Parent gene
- The parent gene g1405 is located on chr_3: 10668436..10671284 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1405 | g1405.t1 | isoform | g1405.t1 | 10668436 | 10671284 |
| chr_3 | g1405 | g1405.t1 | exon | g1405.t1.exon1 | 10668436 | 10668653 |
| chr_3 | g1405 | g1405.t1 | cds | g1405.t1.CDS1 | 10668436 | 10668653 |
| chr_3 | g1405 | g1405.t1 | exon | g1405.t1.exon2 | 10668708 | 10668815 |
| chr_3 | g1405 | g1405.t1 | cds | g1405.t1.CDS2 | 10668708 | 10668815 |
| chr_3 | g1405 | g1405.t1 | exon | g1405.t1.exon3 | 10668875 | 10668990 |
| chr_3 | g1405 | g1405.t1 | cds | g1405.t1.CDS3 | 10668875 | 10668990 |
| chr_3 | g1405 | g1405.t1 | exon | g1405.t1.exon4 | 10669057 | 10669510 |
| chr_3 | g1405 | g1405.t1 | cds | g1405.t1.CDS4 | 10669057 | 10669510 |
| chr_3 | g1405 | g1405.t1 | exon | g1405.t1.exon5 | 10669565 | 10669784 |
| chr_3 | g1405 | g1405.t1 | cds | g1405.t1.CDS5 | 10669565 | 10669784 |
| chr_3 | g1405 | g1405.t1 | exon | g1405.t1.exon6 | 10671186 | 10671284 |
| chr_3 | g1405 | g1405.t1 | cds | g1405.t1.CDS6 | 10671186 | 10671284 |
| chr_3 | g1405 | g1405.t1 | TSS | g1405.t1 | NA | NA |
| chr_3 | g1405 | g1405.t1 | TTS | g1405.t1 | NA | NA |
Sequences
>g1405.t1 Gene=g1405 Length=1215
ATGGCACCAAATAACTCCTTAGTACCAACAGCAGTTGAAAAAGAAAATACTGTTGTAAAG
GATGATCACTCAAATGAAGCAAATATTGGATTATTGAATAGAAAGAACAAAAATGTGTTA
AATTCAAATGATCAAATAAAGCAAGATTTAGATCAAAATGGAAATGAAATCGAAGTTCAA
TATGAAAATCAACTTATAAATGATGAAGAAGAATATAAAATAGAATATGCATGGTTTAAC
ATCATTGGATTTATATTTTTACATTATGCATTAATTATTGGAATTACAAAAATTAAAATT
GATCCACTTCATGTCTTTACTTTCATTTTTGGAATGTTCACTGGCTTTGGAATAACAGCA
GGAGCACATCGTTTATGGGCTCATGGAAGTTACAAGGCAAATTTAGGTTTAAGACTTTTC
CTAACTTTTTGGCAAACAGCAGCATTTCAAAATAGCATCTATGAATGGACAAGAGATCAT
CGAGTTCATCATAAATTTACTGACACTAATGCAGATCCTCACAATGCAAGTCGTGGCTTT
TTCTTTTCACATATAGGCTGGTTAATGTGTAAAAAACATCCTGATGTAAAGAAGTTTGGC
AAGAAAGTTGACTTGAGTGATTTAAAACGTGATCCAATTGTGATGTTTCAACATAAATAT
TATCTTATCCTTATGCCAATCTGTTGTTTTTTAATTCCAATTTTTATACCAACACTTTGG
GGTGTTTCATTCATAAACTCAACATATGCATGCATTTTACGTTGGGTTATCGTACTTCAT
TTTACATGGCTGGTGAATTCCTATGCACATATCTGGGGAAATAAACCTTATAATGAAAAT
ATCAAGCCTACAGATTCTTATACTGTTTCAATGCTGGCATTTGGCGAAGGCTGGCACAAT
TATCATCATGTCTTTCCTTATGATTATAAAACTTCAGAACATGGAAAATATTGGTGCAAT
TACACGACTGGATTTTTGGAATTTTGTGCTAAAATTGGTTGGGCAACAGATTTAAAAACA
GTCAGTGCAGAAGTAATTCGTAAACGTGTGTTAAGAACAGGCGATGGAAGTCATTCGATA
AGTCAAAATAATTCACAACAATCAACTCAGAAGAAAAAGAATGAGCGTGAAGAATTTATA
TGGGGTTGGCAAGATAATTTATTAACAGAAAACGAGAAAAAATATGTTACAGTAGTTAAC
AAGTCTTTAGCATGA
>g1405.t1 Gene=g1405 Length=404
MAPNNSLVPTAVEKENTVVKDDHSNEANIGLLNRKNKNVLNSNDQIKQDLDQNGNEIEVQ
YENQLINDEEEYKIEYAWFNIIGFIFLHYALIIGITKIKIDPLHVFTFIFGMFTGFGITA
GAHRLWAHGSYKANLGLRLFLTFWQTAAFQNSIYEWTRDHRVHHKFTDTNADPHNASRGF
FFSHIGWLMCKKHPDVKKFGKKVDLSDLKRDPIVMFQHKYYLILMPICCFLIPIFIPTLW
GVSFINSTYACILRWVIVLHFTWLVNSYAHIWGNKPYNENIKPTDSYTVSMLAFGEGWHN
YHHVFPYDYKTSEHGKYWCNYTTGFLEFCAKIGWATDLKTVSAEVIRKRVLRTGDGSHSI
SQNNSQQSTQKKKNEREEFIWGWQDNLLTENEKKYVTVVNKSLA
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 26 | g1405.t1 | CDD | cd03505 | Delta9-FADS-like | 105 | 339 | 2.68699E-75 |
| 2 | g1405.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 60 | 368 | 3.7E-122 |
| 3 | g1405.t1 | PANTHER | PTHR11351:SF91 | DESATURASE 1, ISOFORM A-RELATED | 60 | 368 | 3.7E-122 |
| 25 | g1405.t1 | PIRSF | PIRSF000345 | OLE1 | 4 | 401 | 1.1E-79 |
| 7 | g1405.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 78 | 98 | 1.5E-50 |
| 5 | g1405.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 123 | 143 | 1.5E-50 |
| 6 | g1405.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 160 | 189 | 1.5E-50 |
| 9 | g1405.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 221 | 239 | 1.5E-50 |
| 4 | g1405.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 252 | 273 | 1.5E-50 |
| 8 | g1405.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 295 | 309 | 1.5E-50 |
| 1 | g1405.t1 | Pfam | PF00487 | Fatty acid desaturase | 104 | 306 | 1.4E-13 |
| 19 | g1405.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 75 | - |
| 21 | g1405.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 76 | 96 | - |
| 15 | g1405.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 97 | 102 | - |
| 24 | g1405.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 103 | 123 | - |
| 18 | g1405.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 124 | 134 | - |
| 23 | g1405.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 135 | 154 | - |
| 14 | g1405.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 155 | 219 | - |
| 22 | g1405.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 220 | 240 | - |
| 17 | g1405.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 241 | 251 | - |
| 20 | g1405.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 252 | 272 | - |
| 16 | g1405.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 273 | 404 | - |
| 11 | g1405.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 76 | 95 | - |
| 10 | g1405.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 127 | - |
| 12 | g1405.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 220 | 242 | - |
| 13 | g1405.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 252 | 274 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006636 | unsaturated fatty acid biosynthetic process | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004768 | stearoyl-CoA 9-desaturase activity | MF |
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
KEGG
Orthology
- This transcript has been annotated with K20416 (palmitoyl-[glycerolipid] 7-desaturase)
Pathway
This gene does not belong to any pathways.
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed