Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Acyl-CoA desaturase 4.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g1406 g1406.t12 isoform g1406.t12 10676480 10686773
chr_3 g1406 g1406.t12 exon g1406.t12.exon1 10676480 10676489
chr_3 g1406 g1406.t12 cds g1406.t12.CDS1 10676480 10676489
chr_3 g1406 g1406.t12 exon g1406.t12.exon2 10676554 10676689
chr_3 g1406 g1406.t12 cds g1406.t12.CDS2 10676554 10676689
chr_3 g1406 g1406.t12 exon g1406.t12.exon3 10679170 10679353
chr_3 g1406 g1406.t12 cds g1406.t12.CDS3 10679170 10679353
chr_3 g1406 g1406.t12 exon g1406.t12.exon4 10679411 10679475
chr_3 g1406 g1406.t12 cds g1406.t12.CDS4 10679411 10679443
chr_3 g1406 g1406.t12 exon g1406.t12.exon5 10686680 10686773
chr_3 g1406 g1406.t12 TSS g1406.t12 10687224 10687224
chr_3 g1406 g1406.t12 TTS g1406.t12 NA NA

Sequences

>g1406.t12 Gene=g1406 Length=489
ACTGAAAATAAATTGAAACTTGTGAAAAATTTAATTACTTTAAAGAATATTCTAAGACTC
TTCGTAATTTAATAAAATTTATAAATAAAAAAAGACAGGATGGTGCACAAAGTTAGCAAC
TCGACAATGGCGATAGCTGAAGTCGATAAAAATGAAAATATGATCAAGACAAAAAATTCG
CTAAATGTTAGCGATGAAAAGCCACGAGACTTTCCTGCTGAATTACCAGGACCAGAATAT
AAACTAGAATTAGTGTGGCGAAATATCATCATTTTTGCATTACTTCATATAGGCTATGTT
GCTGCATTTTTCATCGATAAATTTACAATTACTAAAGTCTTTGGCGTTGTATATGGAATT
TGTGGTGGCTTCGGAATAACAGCAGGTGCTCATCGACTTTGGGCTCATAATTCATACAAA
ACAAATACAGCCTACAAAATTATGCTTCTTATTTTCCAAACAATCGCATTTCAGAACAGT
GCATACGAA

>g1406.t12 Gene=g1406 Length=121
MAIAEVDKNENMIKTKNSLNVSDEKPRDFPAELPGPEYKLELVWRNIIIFALLHIGYVAA
FFIDKFTITKVFGVVYGICGGFGITAGAHRLWAHNSYKTNTAYKIMLLIFQTIAFQNSAY
E

Protein features from InterProScan

Transcript Database ID Name Start End E.value
1 g1406.t12 PANTHER PTHR11351 ACYL-COA DESATURASE 30 121 8.5E-20
2 g1406.t12 PANTHER PTHR11351:SF73 ACYL-COA DESATURASE 30 121 8.5E-20
4 g1406.t12 PRINTS PR00075 Fatty acid desaturase family 1 signature 44 64 7.4E-9
3 g1406.t12 PRINTS PR00075 Fatty acid desaturase family 1 signature 89 109 7.4E-9
10 g1406.t12 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 1 41 -
11 g1406.t12 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 42 63 -
8 g1406.t12 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 64 69 -
12 g1406.t12 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 70 89 -
9 g1406.t12 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 90 100 -
13 g1406.t12 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 101 120 -
7 g1406.t12 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 121 121 -
5 g1406.t12 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 42 64 -
6 g1406.t12 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 71 93 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0055114 NA NA
GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed