| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1406 | g1406.t12 | isoform | g1406.t12 | 10676480 | 10686773 |
| chr_3 | g1406 | g1406.t12 | exon | g1406.t12.exon1 | 10676480 | 10676489 |
| chr_3 | g1406 | g1406.t12 | cds | g1406.t12.CDS1 | 10676480 | 10676489 |
| chr_3 | g1406 | g1406.t12 | exon | g1406.t12.exon2 | 10676554 | 10676689 |
| chr_3 | g1406 | g1406.t12 | cds | g1406.t12.CDS2 | 10676554 | 10676689 |
| chr_3 | g1406 | g1406.t12 | exon | g1406.t12.exon3 | 10679170 | 10679353 |
| chr_3 | g1406 | g1406.t12 | cds | g1406.t12.CDS3 | 10679170 | 10679353 |
| chr_3 | g1406 | g1406.t12 | exon | g1406.t12.exon4 | 10679411 | 10679475 |
| chr_3 | g1406 | g1406.t12 | cds | g1406.t12.CDS4 | 10679411 | 10679443 |
| chr_3 | g1406 | g1406.t12 | exon | g1406.t12.exon5 | 10686680 | 10686773 |
| chr_3 | g1406 | g1406.t12 | TSS | g1406.t12 | 10687224 | 10687224 |
| chr_3 | g1406 | g1406.t12 | TTS | g1406.t12 | NA | NA |
>g1406.t12 Gene=g1406 Length=489
ACTGAAAATAAATTGAAACTTGTGAAAAATTTAATTACTTTAAAGAATATTCTAAGACTC
TTCGTAATTTAATAAAATTTATAAATAAAAAAAGACAGGATGGTGCACAAAGTTAGCAAC
TCGACAATGGCGATAGCTGAAGTCGATAAAAATGAAAATATGATCAAGACAAAAAATTCG
CTAAATGTTAGCGATGAAAAGCCACGAGACTTTCCTGCTGAATTACCAGGACCAGAATAT
AAACTAGAATTAGTGTGGCGAAATATCATCATTTTTGCATTACTTCATATAGGCTATGTT
GCTGCATTTTTCATCGATAAATTTACAATTACTAAAGTCTTTGGCGTTGTATATGGAATT
TGTGGTGGCTTCGGAATAACAGCAGGTGCTCATCGACTTTGGGCTCATAATTCATACAAA
ACAAATACAGCCTACAAAATTATGCTTCTTATTTTCCAAACAATCGCATTTCAGAACAGT
GCATACGAA
>g1406.t12 Gene=g1406 Length=121
MAIAEVDKNENMIKTKNSLNVSDEKPRDFPAELPGPEYKLELVWRNIIIFALLHIGYVAA
FFIDKFTITKVFGVVYGICGGFGITAGAHRLWAHNSYKTNTAYKIMLLIFQTIAFQNSAY
E
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g1406.t12 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 30 | 121 | 8.5E-20 |
| 2 | g1406.t12 | PANTHER | PTHR11351:SF73 | ACYL-COA DESATURASE | 30 | 121 | 8.5E-20 |
| 4 | g1406.t12 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 44 | 64 | 7.4E-9 |
| 3 | g1406.t12 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 89 | 109 | 7.4E-9 |
| 10 | g1406.t12 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 41 | - |
| 11 | g1406.t12 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 42 | 63 | - |
| 8 | g1406.t12 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 64 | 69 | - |
| 12 | g1406.t12 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 70 | 89 | - |
| 9 | g1406.t12 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 90 | 100 | - |
| 13 | g1406.t12 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 101 | 120 | - |
| 7 | g1406.t12 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 121 | 121 | - |
| 5 | g1406.t12 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 42 | 64 | - |
| 6 | g1406.t12 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 71 | 93 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed