General information for g1406.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Acyl-CoA Delta(11) desaturase.
Parent gene
- The parent gene g1406 is located on chr_3: 10676480..10687218 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1406 | g1406.t3 | TTS | g1406.t3 | 10674847 | 10674847 |
| chr_3 | g1406 | g1406.t3 | isoform | g1406.t3 | 10675030 | 10676104 |
| chr_3 | g1406 | g1406.t3 | exon | g1406.t3.exon1 | 10675030 | 10675301 |
| chr_3 | g1406 | g1406.t3 | cds | g1406.t3.CDS1 | 10675030 | 10675301 |
| chr_3 | g1406 | g1406.t3 | exon | g1406.t3.exon2 | 10675362 | 10675469 |
| chr_3 | g1406 | g1406.t3 | cds | g1406.t3.CDS2 | 10675362 | 10675469 |
| chr_3 | g1406 | g1406.t3 | exon | g1406.t3.exon3 | 10675983 | 10676035 |
| chr_3 | g1406 | g1406.t3 | cds | g1406.t3.CDS3 | 10675983 | 10675992 |
| chr_3 | g1406 | g1406.t3 | exon | g1406.t3.exon4 | 10676103 | 10676104 |
| chr_3 | g1406 | g1406.t3 | TSS | g1406.t3 | NA | NA |
Sequences
>g1406.t3 Gene=g1406 Length=435
AAGAATATTTCACCATCTGACAGCTATCTTGTTGGATTTTTAGCTATGGGAGAAGGCTGG
CATAATTATCATCACGTCTTTCCTTATGATTACAAAACTTCAGAATTAGGATTTTACGTG
TTCAACTTAACGACAGCTTTTATTGATTTTTTCTCACTGTTTGGATGGACATATGACCTT
AAAACAGTGTCACCTGAAATGATCAGACGTCGTGTGTTGAGAACAGGTGATGGAAGTCAT
CCAGCATCAAAAGAAATGGATACAAAGGAATTATTGAATAAATTTATCCTAAGTCAAGCA
ATTGACAAAAATGGAAATATAATTCATAATGAAGAAGACTCAATATGGGGATTTAATGAT
GAAATGCTTCCAGCTGAAGATAGAAAATACATTAAAATTATTAACAAACATTCAAATTTA
AAGAAAAGAAATTAA
>g1406.t3 Gene=g1406 Length=129
MGEGWHNYHHVFPYDYKTSELGFYVFNLTTAFIDFFSLFGWTYDLKTVSPEMIRRRVLRT
GDGSHPASKEMDTKELLNKFILSQAIDKNGNIIHNEEDSIWGFNDEMLPAEDRKYIKIIN
KHSNLKKRN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g1406.t3 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 1 | 68 | 4.0E-30 |
| 2 | g1406.t3 | PANTHER | PTHR11351:SF91 | DESATURASE 1, ISOFORM A-RELATED | 1 | 68 | 4.0E-30 |
| 5 | g1406.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 20 | - |
| 6 | g1406.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 21 | 45 | - |
| 4 | g1406.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 46 | 129 | - |
| 3 | g1406.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 21 | 43 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed