General information for g14071.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as 60S ribosomal protein L26.
Parent gene
- The parent gene g14071 is located on chr_1: 34479032..34479589 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g14071 | g14071.t1 | TSS | g14071.t1 | 34478846 | 34478846 |
| chr_1 | g14071 | g14071.t1 | isoform | g14071.t1 | 34478860 | 34479495 |
| chr_1 | g14071 | g14071.t1 | exon | g14071.t1.exon1 | 34478860 | 34479027 |
| chr_1 | g14071 | g14071.t1 | cds | g14071.t1.CDS1 | 34478860 | 34479027 |
| chr_1 | g14071 | g14071.t1 | exon | g14071.t1.exon2 | 34479211 | 34479495 |
| chr_1 | g14071 | g14071.t1 | cds | g14071.t1.CDS2 | 34479211 | 34479495 |
| chr_1 | g14071 | g14071.t1 | TTS | g14071.t1 | 34479591 | 34479591 |
Sequences
>g14071.t1 Gene=g14071 Length=453
ATGAAGTTTAATAGAAACGTCTCATCATCGCGTCGCAAGAGTCGTCTTCGACATTTTACA
GCTCCATCGCATATTCGTAGAAAGATAATGTCATCACCATTGAGCAAAGAACTCAGACAA
AAATATAATGTTCGCTCAATGCCAATTCGTAAAGATGATGAAGTTCAAGTCGTTCGTGGT
CACTATAAAGGAAATCAAGTTGGCAAAGTAGTGCAAGTGTACAGAAAGAAATTTGTTGTG
TACATTGAACGAATCCAGCGCGAGAAGGCAAATGGAACTAATGTTTATGTTGGAATTCAT
CCATCAAAACTTTTGATTGTCAAACTCAAGATGGACAAAGACCGCAAACGCATCTTGGAT
CGCAGAGCAAAGGGACGTTTGGCTGCTCTTGGAAAAGATAAGGGCAAATATACAGAAGAA
ACAGCTGCTGCTCCAATGGAAACTACATCCTAA
>g14071.t1 Gene=g14071 Length=150
MKFNRNVSSSRRKSRLRHFTAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG
HYKGNQVGKVVQVYRKKFVVYIERIQREKANGTNVYVGIHPSKLLIVKLKMDKDRKRILD
RRAKGRLAALGKDKGKYTEETAAAPMETTS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g14071.t1 | CDD | cd06089 | KOW_RPL26 | 52 | 106 | 1.26967E-13 |
| 8 | g14071.t1 | Gene3D | G3DSA:2.30.30.30 | - | 1 | 147 | 7.5E-63 |
| 5 | g14071.t1 | Hamap | MF_01326_A | 50S ribosomal protein L24 [rplX]. | 9 | 122 | 20.841011 |
| 3 | g14071.t1 | PANTHER | PTHR11143 | 60S RIBOSOMAL PROTEIN L26 FAMILY MEMBER | 1 | 141 | 9.1E-78 |
| 4 | g14071.t1 | PANTHER | PTHR11143:SF10 | 60S RIBOSOMAL PROTEIN L26-LIKE 1 | 1 | 141 | 9.1E-78 |
| 1 | g14071.t1 | Pfam | PF16906 | Ribosomal proteins L26 eukaryotic, L24P archaeal | 8 | 122 | 1.9E-39 |
| 2 | g14071.t1 | Pfam | PF00467 | KOW motif | 51 | 83 | 1.5E-7 |
| 10 | g14071.t1 | ProSitePatterns | PS01108 | Ribosomal protein L24 signature. | 52 | 70 | - |
| 11 | g14071.t1 | SMART | SM00739 | kow_9 | 48 | 76 | 0.0026 |
| 6 | g14071.t1 | SUPERFAMILY | SSF50104 | Translation proteins SH3-like domain | 8 | 126 | 2.56E-35 |
| 7 | g14071.t1 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | 1 | 10 | - |
| 12 | g14071.t1 | TIGRFAM | TIGR01080 | rplX_A_E: ribosomal protein uL24 | 8 | 123 | 3.2E-46 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0003723 | RNA binding | MF |
| GO:0015934 | large ribosomal subunit | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
KEGG
Orthology
- This transcript has been annotated with K02898 (large subunit ribosomal protein L26e)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
