Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative 60S ribosomal protein L26.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g14071 g14071.t16 TSS g14071.t16 34478846 34478846
chr_1 g14071 g14071.t16 isoform g14071.t16 34479032 34479495
chr_1 g14071 g14071.t16 exon g14071.t16.exon1 34479032 34479129
chr_1 g14071 g14071.t16 cds g14071.t16.CDS1 34479085 34479129
chr_1 g14071 g14071.t16 exon g14071.t16.exon2 34479211 34479495
chr_1 g14071 g14071.t16 cds g14071.t16.CDS2 34479211 34479495
chr_1 g14071 g14071.t16 TTS g14071.t16 34479591 34479591

Sequences

>g14071.t16 Gene=g14071 Length=383
GTTGATTAATTAAGAATTAAGGACATTCTTTGTAATGGATCATTTACTACCTAATGATGT
CTATTTTACTTTGTTTTTATAAAATTATTTTATGTTTTGTCGTTCGTGGTCACTATAAAG
GAAATCAAGTTGGCAAAGTAGTGCAAGTGTACAGAAAGAAATTTGTTGTGTACATTGAAC
GAATCCAGCGCGAGAAGGCAAATGGAACTAATGTTTATGTTGGAATTCATCCATCAAAAC
TTTTGATTGTCAAACTCAAGATGGACAAAGACCGCAAACGCATCTTGGATCGCAGAGCAA
AGGGACGTTTGGCTGCTCTTGGAAAAGATAAGGGCAAATATACAGAAGAAACAGCTGCTG
CTCCAATGGAAACTACATCCTAA

>g14071.t16 Gene=g14071 Length=109
MMSILLCFYKIILCFVVRGHYKGNQVGKVVQVYRKKFVVYIERIQREKANGTNVYVGIHP
SKLLIVKLKMDKDRKRILDRRAKGRLAALGKDKGKYTEETAAAPMETTS

Protein features from InterProScan

Transcript Database ID Name Start End E.value
13 g14071.t16 CDD cd06089 KOW_RPL26 16 65 4.27893E-11
7 g14071.t16 Gene3D G3DSA:2.30.30.30 - 15 106 1.2E-31
3 g14071.t16 PANTHER PTHR11143 60S RIBOSOMAL PROTEIN L26 FAMILY MEMBER 16 100 4.7E-40
4 g14071.t16 PANTHER PTHR11143:SF10 60S RIBOSOMAL PROTEIN L26-LIKE 1 16 100 4.7E-40
2 g14071.t16 Pfam PF00467 KOW motif 14 42 1.8E-6
1 g14071.t16 Pfam PF16906 Ribosomal proteins L26 eukaryotic, L24P archaeal 43 81 4.5E-15
9 g14071.t16 Phobius SIGNAL_PEPTIDE Signal peptide region 1 19 -
10 g14071.t16 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 3 -
11 g14071.t16 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 4 15 -
12 g14071.t16 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 16 19 -
8 g14071.t16 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 20 109 -
5 g14071.t16 SUPERFAMILY SSF50104 Translation proteins SH3-like domain 15 85 1.58E-16
6 g14071.t16 SignalP_EUK SignalP-noTM SignalP-noTM 1 19 -
14 g14071.t16 TIGRFAM TIGR01080 rplX_A_E: ribosomal protein uL24 16 82 1.1E-21

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0003723 RNA binding MF
GO:0015934 large ribosomal subunit CC
GO:0006412 translation BP
GO:0003735 structural constituent of ribosome MF

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values