| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g14114 | g14114.t3 | isoform | g14114.t3 | 34785173 | 34786137 |
| chr_1 | g14114 | g14114.t3 | exon | g14114.t3.exon1 | 34785173 | 34785363 |
| chr_1 | g14114 | g14114.t3 | cds | g14114.t3.CDS1 | 34785173 | 34785363 |
| chr_1 | g14114 | g14114.t3 | exon | g14114.t3.exon2 | 34785428 | 34785742 |
| chr_1 | g14114 | g14114.t3 | cds | g14114.t3.CDS2 | 34785428 | 34785728 |
| chr_1 | g14114 | g14114.t3 | exon | g14114.t3.exon3 | 34786129 | 34786137 |
| chr_1 | g14114 | g14114.t3 | TSS | g14114.t3 | 34786310 | 34786310 |
| chr_1 | g14114 | g14114.t3 | TTS | g14114.t3 | NA | NA |
>g14114.t3 Gene=g14114 Length=515
CAAAAGTAAAAGAAAAACAACCGATGACAAAAAAACTTACAAAATTTAAAATAAAATTTC
ATAACATGTCTTATCCACTTTCACCGAACAGTTATTGGTTGATTTTTGGCATCTTCATTC
CTTTCTATTTTCCTCTTCAACAAGGCGATGTTTATTTAAAAGTGATAGGAAAAATGGCAT
TATATAGCTTTATTTTATGGATAAGATTGTGTGTGATTTGCCGATTTTTATTGACACTTG
TGCTAAAACATAAAGGACTGATTTTAGAAACAAGAGGGCAAAATCCAACTTTTAAGACTA
AAATGTATAAATATTTTCTTGAAAAACTTAAAGTCTGGAACAAACCACTCTTCTTTAGTT
TTCAAAATGCTCTACCTCGTTTGTCTGTACCCGATTTAAAAGTCACAATTAAAAAGTATT
TAGACTCAATTCGAAGCTTTACTGATGATGAGAATTATGAAAGAATTAAAAAAGAAGCAG
AAACTTTCGAGAATGGACTTGGAAAGAAAATTCAA
>g14114.t3 Gene=g14114 Length=164
MTKKLTKFKIKFHNMSYPLSPNSYWLIFGIFIPFYFPLQQGDVYLKVIGKMALYSFILWI
RLCVICRFLLTLVLKHKGLILETRGQNPTFKTKMYKYFLEKLKVWNKPLFFSFQNALPRL
SVPDLKVTIKKYLDSIRSFTDDENYERIKKEAETFENGLGKKIQ
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g14114.t3 | Gene3D | G3DSA:1.10.275.20 | - | 100 | 164 | 9.5E-15 |
| 2 | g14114.t3 | PANTHER | PTHR22589:SF31 | CARNITINE PALMITOYLTRANSFERASE I | 42 | 164 | 4.7E-20 |
| 3 | g14114.t3 | PANTHER | PTHR22589 | CARNITINE O-ACYLTRANSFERASE | 42 | 164 | 4.7E-20 |
| 1 | g14114.t3 | Pfam | PF00755 | Choline/Carnitine o-acyltransferase | 117 | 164 | 2.0E-10 |
| 8 | g14114.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 20 | - |
| 12 | g14114.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 21 | 39 | - |
| 10 | g14114.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 40 | 50 | - |
| 11 | g14114.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 51 | 74 | - |
| 9 | g14114.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 75 | 164 | - |
| 6 | g14114.t3 | SUPERFAMILY | SSF52777 | CoA-dependent acyltransferases | 109 | 164 | 1.61E-13 |
| 5 | g14114.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 37 | - |
| 4 | g14114.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 52 | 74 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016746 | acyltransferase activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.