| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g14120 | g14120.t11 | isoform | g14120.t11 | 34806106 | 34806628 |
| chr_1 | g14120 | g14120.t11 | exon | g14120.t11.exon1 | 34806106 | 34806383 |
| chr_1 | g14120 | g14120.t11 | cds | g14120.t11.CDS1 | 34806106 | 34806383 |
| chr_1 | g14120 | g14120.t11 | exon | g14120.t11.exon2 | 34806454 | 34806628 |
| chr_1 | g14120 | g14120.t11 | cds | g14120.t11.CDS2 | 34806454 | 34806628 |
| chr_1 | g14120 | g14120.t11 | TSS | g14120.t11 | NA | NA |
| chr_1 | g14120 | g14120.t11 | TTS | g14120.t11 | NA | NA |
>g14120.t11 Gene=g14120 Length=453
ATGGCTGAAGCCCATCAAGCCGTTGCCTTTAGTTTTGCTATCACTCATGAAGGATTTAAT
GTCAACTATGATCGTGAAGTTCTTCATCTTGTCTGGGAATCAGGTGTGAGATCATGGAAG
AAAAGAGTCGCAAGAATAAAAGCTGGAATTAAAAATGGAGCTTATCCAGCTCATTTAGAA
TCACTTTATGTTATTATGATATTAGTAACATTACTACATTTCTCAAACAAAACAGTTCCA
TATGATTTGGTCAATACATTTATGAATGTAATGCCAAGTAATGGATCATTTTGGCACTTT
CTCTCATGTGTTCTTGTATCACTTTTTTATTGGATTTTGATTTGTTTAATTATGCGTTAT
TCATTGAAAGGATTATTGGTCTATAAAGGCTGGATGTATGAAGCACGTGGATCAGGTTCT
AAACCAAGTCTTAAAACAAAAATTTGGTTTGTC
>g14120.t11 Gene=g14120 Length=151
MAEAHQAVAFSFAITHEGFNVNYDREVLHLVWESGVRSWKKRVARIKAGIKNGAYPAHLE
SLYVIMILVTLLHFSNKTVPYDLVNTFMNVMPSNGSFWHFLSCVLVSLFYWILICLIMRY
SLKGLLVYKGWMYEARGSGSKPSLKTKIWFV
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g14120.t11 | Pfam | PF16484 | Carnitine O-palmitoyltransferase N-terminus | 1 | 47 | 6.0E-25 |
| 5 | g14120.t11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 54 | - |
| 8 | g14120.t11 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 55 | 76 | - |
| 6 | g14120.t11 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 77 | 95 | - |
| 7 | g14120.t11 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 96 | 122 | - |
| 4 | g14120.t11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 123 | 151 | - |
| 3 | g14120.t11 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 75 | - |
| 2 | g14120.t11 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 95 | 117 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed