| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g14165 | g14165.t1 | TSS | g14165.t1 | 35140656 | 35140656 |
| chr_1 | g14165 | g14165.t1 | isoform | g14165.t1 | 35140686 | 35141514 |
| chr_1 | g14165 | g14165.t1 | exon | g14165.t1.exon1 | 35140686 | 35141003 |
| chr_1 | g14165 | g14165.t1 | cds | g14165.t1.CDS1 | 35140686 | 35141003 |
| chr_1 | g14165 | g14165.t1 | exon | g14165.t1.exon2 | 35141059 | 35141514 |
| chr_1 | g14165 | g14165.t1 | cds | g14165.t1.CDS2 | 35141059 | 35141514 |
| chr_1 | g14165 | g14165.t1 | TTS | g14165.t1 | NA | NA |
>g14165.t1 Gene=g14165 Length=774
ATGATTTTAAAAGCGATTTTCAAGTTTTTCAATCCATTAGTGGTTTATATTCCCTTTGTT
TTTGGCATCACAAAGATTTTTGAGATGATTTTAGGATACCAAAATATTTGGAATAGTTTG
TGGAATCAAATTGTTCTTTATTTGGGACAAGATGAATTGACTTATGTTGTTTGTCTTCCA
AATTTAATATTTCTTGCACTTTCATTAGGTTTGGGCTGGGTTTATAATATTTTAGATGTA
CTTGATGCACCAAAATGTTTAACAAAATACAGATTAAATGAATTAACAAATAATAATAAA
AAAATTGATTTATTTAAGGTCTCAATGAATGTATTGCAAAATAATCTCCTAAATCCTATC
ATGACCATTTCAACTTTTTACTTGTGTAAAAAATTTATCAGTTATGAGTTTAAACTTGAA
GCACCAAGTTTTTTTATTTTAATTCGTGATTTAAGTTTTTACATTATTGTACAAGATATT
TTTACTTTCTATATTCATCGTTTATTGCATAATCCAATATTTTACAAGTATCACAAGAAA
CATCATCAAATGAAACCTACAAGAGCACTTAACGCAATAAGATTTGACTTTTTTGATTAT
TTTTTTGCAAATTATATTCCTTTCATTATTGGAATGATTATTCATCATCCCCATGTTGCA
ACAGGAATTTTATGGTCTATTATTACTTCATTTACATCTACTACAATCCATTGTGGCTAC
GGTTTTCCAAGTTTTTATTGTATTCAGTTTCACAATGATCATCATTTGAAGTGA
>g14165.t1 Gene=g14165 Length=257
MILKAIFKFFNPLVVYIPFVFGITKIFEMILGYQNIWNSLWNQIVLYLGQDELTYVVCLP
NLIFLALSLGLGWVYNILDVLDAPKCLTKYRLNELTNNNKKIDLFKVSMNVLQNNLLNPI
MTISTFYLCKKFISYEFKLEAPSFFILIRDLSFYIIVQDIFTFYIHRLLHNPIFYKYHKK
HHQMKPTRALNAIRFDFFDYFFANYIPFIIGMIIHHPHVATGILWSIITSFTSTTIHCGY
GFPSFYCIQFHNDHHLK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g14165.t1 | PANTHER | PTHR11863:SF26 | FATTY ACID HYDROXYLASE DOMAIN-CONTAINING PROTEIN 2 | 27 | 257 | 1.1E-33 |
| 3 | g14165.t1 | PANTHER | PTHR11863 | STEROL DESATURASE | 27 | 257 | 1.1E-33 |
| 1 | g14165.t1 | Pfam | PF04116 | Fatty acid hydroxylase superfamily | 153 | 256 | 4.6E-14 |
| 8 | g14165.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 14 | g14165.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 33 | - |
| 11 | g14165.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 34 | 52 | - |
| 16 | g14165.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 75 | - |
| 10 | g14165.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 76 | 196 | - |
| 15 | g14165.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 197 | 217 | - |
| 12 | g14165.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 218 | 222 | - |
| 13 | g14165.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 223 | 248 | - |
| 9 | g14165.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 249 | 257 | - |
| 6 | g14165.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 13 | 33 | - |
| 7 | g14165.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 75 | - |
| 5 | g14165.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 197 | 219 | - |
| 4 | g14165.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 223 | 245 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005506 | iron ion binding | MF |
| GO:0055114 | NA | NA |
| GO:0016491 | oxidoreductase activity | MF |
| GO:0008610 | lipid biosynthetic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed