General information for g14286.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g14286 is located on chr_1: 36307973..36311036 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g14286 | g14286.t1 | TTS | g14286.t1 | 36307762 | 36307762 |
| chr_1 | g14286 | g14286.t1 | isoform | g14286.t1 | 36307973 | 36311036 |
| chr_1 | g14286 | g14286.t1 | exon | g14286.t1.exon1 | 36307973 | 36308157 |
| chr_1 | g14286 | g14286.t1 | cds | g14286.t1.CDS1 | 36307973 | 36308157 |
| chr_1 | g14286 | g14286.t1 | exon | g14286.t1.exon2 | 36310892 | 36310963 |
| chr_1 | g14286 | g14286.t1 | cds | g14286.t1.CDS2 | 36310892 | 36310963 |
| chr_1 | g14286 | g14286.t1 | exon | g14286.t1.exon3 | 36311024 | 36311036 |
| chr_1 | g14286 | g14286.t1 | cds | g14286.t1.CDS3 | 36311024 | 36311036 |
| chr_1 | g14286 | g14286.t1 | TSS | g14286.t1 | NA | NA |
Sequences
>g14286.t1 Gene=g14286 Length=270
ATGAGCATGAAAGAAGAGATCCAGCAAAAAAATCTAATTTCTGGAAGTTCAACTGGACTA
TTTGGAACAGAGTTCATATTTCATGTTGTTTTAGCTCGTGTAATCAAAGTCTTGGGGCGT
ACAGGCTCCCAAGGTCAATGTACACAAGTAAAAGTCGAGTTCTTAAATGATCCAACCCGT
GCTATCATCAGAAATGTGAAAGGACCAGTTCGTGAGGGTGACATTTTAACTTTACTCGAG
TCTGAACGTGAAGCTAGAAGACTTCGATAA
>g14286.t1 Gene=g14286 Length=89
MSMKEEIQQKNLISGSSTGLFGTEFIFHVVLARVIKVLGRTGSQGQCTQVKVEFLNDPTR
AIIRNVKGPVREGDILTLLESEREARRLR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g14286.t1 | CDD | cd04457 | S1_S28E | 31 | 89 | 3.15358E-32 |
| 7 | g14286.t1 | Gene3D | G3DSA:2.40.50.140 | - | 26 | 89 | 3.8E-35 |
| 4 | g14286.t1 | Hamap | MF_00292 | 30S ribosomal protein S28e [rps28e]. | 3 | 89 | 20.470772 |
| 2 | g14286.t1 | PANTHER | PTHR10769 | 40S RIBOSOMAL PROTEIN S28 | 29 | 89 | 2.4E-30 |
| 3 | g14286.t1 | PANTHER | PTHR10769:SF3 | 40S RIBOSOMAL PROTEIN S28 | 29 | 89 | 2.4E-30 |
| 1 | g14286.t1 | Pfam | PF01200 | Ribosomal protein S28e | 29 | 88 | 2.3E-31 |
| 6 | g14286.t1 | ProSitePatterns | PS00961 | Ribosomal protein S28e signature. | 80 | 88 | - |
| 5 | g14286.t1 | SUPERFAMILY | SSF50249 | Nucleic acid-binding proteins | 28 | 89 | 2.83E-25 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
KEGG
Orthology
- This transcript has been annotated with K02979 (small subunit ribosomal protein S28e)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
