| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g14309 | g14309.t23 | TTS | g14309.t23 | 36551672 | 36551672 |
| chr_1 | g14309 | g14309.t23 | isoform | g14309.t23 | 36552119 | 36554119 |
| chr_1 | g14309 | g14309.t23 | exon | g14309.t23.exon1 | 36552119 | 36552137 |
| chr_1 | g14309 | g14309.t23 | cds | g14309.t23.CDS1 | 36552128 | 36552137 |
| chr_1 | g14309 | g14309.t23 | exon | g14309.t23.exon2 | 36552665 | 36553070 |
| chr_1 | g14309 | g14309.t23 | cds | g14309.t23.CDS2 | 36552665 | 36553062 |
| chr_1 | g14309 | g14309.t23 | exon | g14309.t23.exon3 | 36553948 | 36554119 |
| chr_1 | g14309 | g14309.t23 | TSS | g14309.t23 | 36554119 | 36554119 |
>g14309.t23 Gene=g14309 Length=597
ACTTTGAATTGAGTTGTTGAAGAGTTTAGACGTTTTCTGTGAACGGTCTTTTGAATCATT
TTTTCCAATAAAAAATTAATTAAATCAATAGTGCTGTGTTTTAAAATTGCCGTAAAAGCA
TTCTCAAATCACCAATACTTTCTTTATTGTGAAATTTAAGGACTAAAACAAGAAATCAAA
ATGTGTGACGAAGAAGTTGCTGCATTGGTCGTTGACAATGGATCAGGAATGTGCAAAGCC
GGTTTTGCTGGTGATGATGCACCACGTGCCGTTTTCCCATCAATTGTCGGTCGTCCACGT
CATCAAGGCGTTATGGTCGGTATGGGACAAAAGGACTCATATGTTGGTGATGAGGCTCAA
AGCAAAAGAGGTATTCTTACCTTGAAATATCCAATTGAACACGGTATTGTTACAAACTGG
GATGATATGGAAAAGATCTGGCATCATACTTTCTACAATGAACTCCGTGTTGCACCTGAA
GAACATCCAGTCTTGCTTACCGAAGCTCCATTAAATCCAAAAGCAAATCGTGAAAAGATG
ACACAAATTATGTTCGAGACATTCAACACACCAGCTATGTATCGCTGATCGTATGCA
>g14309.t23 Gene=g14309 Length=135
MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNTPAMYR
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g14309.t23 | CDD | cd00012 | NBD_sugar-kinase_HSP70_actin | 9 | 134 | 9.64887E-10 |
| 9 | g14309.t23 | Gene3D | G3DSA:2.30.36.70 | Actin; Chain A | 35 | 72 | 1.1E-29 |
| 2 | g14309.t23 | PANTHER | PTHR11937:SF193 | ACTIN, ALPHA SKELETAL MUSCLE | 2 | 134 | 3.0E-91 |
| 3 | g14309.t23 | PANTHER | PTHR11937 | ACTIN | 2 | 134 | 3.0E-91 |
| 5 | g14309.t23 | PRINTS | PR00190 | Actin signature | 27 | 36 | 5.5E-33 |
| 6 | g14309.t23 | PRINTS | PR00190 | Actin signature | 50 | 61 | 5.5E-33 |
| 7 | g14309.t23 | PRINTS | PR00190 | Actin signature | 62 | 84 | 5.5E-33 |
| 4 | g14309.t23 | PRINTS | PR00190 | Actin signature | 116 | 129 | 5.5E-33 |
| 1 | g14309.t23 | Pfam | PF00022 | Actin | 4 | 134 | 3.6E-49 |
| 12 | g14309.t23 | ProSitePatterns | PS00406 | Actins signature 1. | 54 | 64 | - |
| 11 | g14309.t23 | ProSitePatterns | PS01132 | Actins and actin-related proteins signature. | 105 | 117 | - |
| 13 | g14309.t23 | SMART | SM00268 | actin_3 | 6 | 135 | 1.7E-5 |
| 8 | g14309.t23 | SUPERFAMILY | SSF53067 | Actin-like ATPase domain | 5 | 134 | 3.88E-60 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.