General information for g14434.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial.
Parent gene
- The parent gene g14434 is located on chr_4: 515236..516579 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g14434 | g14434.t1 | TTS | g14434.t1 | 514857 | 514857 |
| chr_4 | g14434 | g14434.t1 | isoform | g14434.t1 | 514931 | 515236 |
| chr_4 | g14434 | g14434.t1 | exon | g14434.t1.exon1 | 514931 | 515236 |
| chr_4 | g14434 | g14434.t1 | cds | g14434.t1.CDS1 | 514931 | 515236 |
| chr_4 | g14434 | g14434.t1 | TSS | g14434.t1 | 515280 | 515280 |
Sequences
>g14434.t1 Gene=g14434 Length=306
ATGAATAGTTTATCAGCAAAATTTCAATTTTATTCCAAGAAAAGATTGTTTCGATATGGA
TTGCCATTCCTTTTATTTGTCGCTGGTGGATCATTTGGATTAAGAGAATTCACAAAGTTA
CGGTATCAATTTAGTAAAAAAACAACAATAAAACCTGAAGAGCTTGAGAAAAAAGGAATT
GAAATGAAAAAGCCTGGTGAAGTGACATTAGAGTCTGAATTTGAGAAAATTAAGACATTG
GATATAGACAATTGGGAACCAATAAGAGGCCCGAGACCTTGGGAACAACAACCTCAGAAG
AAATAA
>g14434.t1 Gene=g14434 Length=101
MNSLSAKFQFYSKKRLFRYGLPFLLFVAGGSFGLREFTKLRYQFSKKTTIKPEELEKKGI
EMKKPGEVTLESEFEKIKTLDIDNWEPIRGPRPWEQQPQKK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g14434.t1 | PANTHER | PTHR17130 | MITOCHONDRIAL OUTER MEMBRANE PROTEIN 25 | 7 | 99 | 2.1E-26 |
| 1 | g14434.t1 | Pfam | PF14138 | Cytochrome c oxidase assembly protein COX16 | 17 | 95 | 8.8E-24 |
| 5 | g14434.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 33 | - |
| 6 | g14434.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 19 | - |
| 7 | g14434.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 20 | 28 | - |
| 8 | g14434.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 29 | 33 | - |
| 4 | g14434.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 34 | 101 | - |
| 3 | g14434.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 15 | 34 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0031966 | mitochondrial membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K18182 (cytochrome c oxidase assembly protein subunit 16)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
