| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g14776 | g14776.t4 | TSS | g14776.t4 | 2272211 | 2272211 |
| chr_4 | g14776 | g14776.t4 | isoform | g14776.t4 | 2272368 | 2273487 |
| chr_4 | g14776 | g14776.t4 | exon | g14776.t4.exon1 | 2272368 | 2272374 |
| chr_4 | g14776 | g14776.t4 | exon | g14776.t4.exon2 | 2272648 | 2272725 |
| chr_4 | g14776 | g14776.t4 | cds | g14776.t4.CDS1 | 2272659 | 2272725 |
| chr_4 | g14776 | g14776.t4 | exon | g14776.t4.exon3 | 2273099 | 2273487 |
| chr_4 | g14776 | g14776.t4 | cds | g14776.t4.CDS2 | 2273099 | 2273487 |
| chr_4 | g14776 | g14776.t4 | TTS | g14776.t4 | NA | NA |
>g14776.t4 Gene=g14776 Length=474
AATTAAGTGCATTCAAAAATGGGTCTCACAATTTCAAGTGTCTTCAATCGACTTTTTGGA
AAAAAGCAGATGAGGATTTTAATGGTCGGTCTCGATGCAGCTGGTAAAACCACAATTCTC
TACAAATTAAAACTCGGTGAAATTGTCACAACCATTCCAACAATTGGTTTCAATGTCGAG
ACAGTAGAATACAAAAACATTTGTTTCACAGTGTGGGATGTTGGTGGTCAAGATAAAATT
CGTCCACTTTGGCGTCATTATTTCCAAAACACTCAAGGTCTCATTTTTGTCGTTGATTCA
AATGATCGTGAGCGTGTTGTTGAAGCTGAAAGGGAACTTCATAATATGTTGAATGAAGAT
GAACTTCGTGATGCAGTGATTTTGGTATTTGCAAACAAACAAGATTTGCCAAATGCAATG
AGCGCATCGGAATTGACTGAAAAATTAAGGTTGAATTCACTGCATAATAGAAGT
>g14776.t4 Gene=g14776 Length=152
MGLTISSVFNRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEAERELHNMLNEDELRDAV
ILVFANKQDLPNAMSASELTEKLRLNSLHNRS
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g14776.t4 | CDD | cd04150 | Arf1_5_like | 18 | 152 | 0.000 |
| 9 | g14776.t4 | Gene3D | G3DSA:3.40.50.300 | - | 18 | 152 | 0.000 |
| 2 | g14776.t4 | PANTHER | PTHR11711 | ADP RIBOSYLATION FACTOR-RELATED | 1 | 151 | 0.000 |
| 3 | g14776.t4 | PANTHER | PTHR11711:SF386 | ADP-RIBOSYLATION FACTOR 5 | 1 | 151 | 0.000 |
| 4 | g14776.t4 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 19 | 42 | 0.000 |
| 7 | g14776.t4 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 47 | 71 | 0.000 |
| 5 | g14776.t4 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 74 | 99 | 0.000 |
| 6 | g14776.t4 | PRINTS | PR00328 | GTP-binding SAR1 protein signature | 119 | 140 | 0.000 |
| 1 | g14776.t4 | Pfam | PF00025 | ADP-ribosylation factor family | 6 | 150 | 0.000 |
| 15 | g14776.t4 | ProSiteProfiles | PS51417 | small GTPase Arf family profile. | 11 | 152 | 20.220 |
| 11 | g14776.t4 | SMART | SM00177 | arf_sub_2 | 1 | 152 | 0.000 |
| 13 | g14776.t4 | SMART | SM00178 | sar_sub_1 | 1 | 152 | 0.000 |
| 12 | g14776.t4 | SMART | SM00175 | rab_sub_5 | 18 | 151 | 0.009 |
| 8 | g14776.t4 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 14 | 141 | 0.000 |
| 14 | g14776.t4 | TIGRFAM | TIGR00231 | small_GTP: small GTP-binding protein domain | 16 | 146 | 0.000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005525 | GTP binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.