General information for g14853.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g14853 is located on chr_4: 2665804..2666416 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g14853 | g14853.t1 | isoform | g14853.t1 | 2665115 | 2665804 |
| chr_4 | g14853 | g14853.t1 | exon | g14853.t1.exon1 | 2665115 | 2665201 |
| chr_4 | g14853 | g14853.t1 | cds | g14853.t1.CDS1 | 2665115 | 2665201 |
| chr_4 | g14853 | g14853.t1 | exon | g14853.t1.exon2 | 2665487 | 2665804 |
| chr_4 | g14853 | g14853.t1 | cds | g14853.t1.CDS2 | 2665487 | 2665804 |
| chr_4 | g14853 | g14853.t1 | TSS | g14853.t1 | 2665548 | 2665548 |
| chr_4 | g14853 | g14853.t1 | TTS | g14853.t1 | 2666017 | 2666017 |
Sequences
>g14853.t1 Gene=g14853 Length=405
ATGTCATCAAAAAAAGGCAACAAAAAACGAGCAGCAAATCCAGATGATGATCCAGTATAT
GCAGAGAAACGAGCAAGAAATAATGAAGCTGTAAGAAAATCCCGAGACAAATCAAAGAAG
AAAGCTGAAGAAACAATGGCAAGAGTACAAAAACTAAAAGAAGAAAACAAAAAATTAGAA
GGAAAAATTGATGAACAAAAGAAAACTAAAAAATTCTTAAAGGATCTTTTCTTACAACAA
ACGACAGCTAAAATGCAAAATCCAACACCAGAACAATGGGCATTAATAAATGAGGAAAAT
TCAGAAGATGAAATTGAATCGGAAGTTTCAACACAGTCTTCAATAGATGAAAGTTCTTCT
TCTGAAGAAGAGCCGGCACCAAAACGTAAAAGAGGCAAAAAGTGA
>g14853.t1 Gene=g14853 Length=134
MSSKKGNKKRAANPDDDPVYAEKRARNNEAVRKSRDKSKKKAEETMARVQKLKEENKKLE
GKIDEQKKTKKFLKDLFLQQTTAKMQNPTPEQWALINEENSEDEIESEVSTQSSIDESSS
SEEEPAPKRKRGKK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g14853.t1 | Coils | Coil | Coil | 35 | 76 | - |
| 5 | g14853.t1 | Gene3D | G3DSA:1.20.5.170 | - | 4 | 82 | 2.6E-17 |
| 9 | g14853.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 66 | - |
| 11 | g14853.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 8 | 66 | - |
| 8 | g14853.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 82 | 96 | - |
| 10 | g14853.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 82 | 134 | - |
| 2 | g14853.t1 | PANTHER | PTHR23334:SF58 | CCAAT/ENHANCER-BINDING PROTEIN GAMMA-LIKE PROTEIN | 8 | 109 | 3.1E-18 |
| 3 | g14853.t1 | PANTHER | PTHR23334 | CCAAT/ENHANCER BINDING PROTEIN | 8 | 109 | 3.1E-18 |
| 1 | g14853.t1 | Pfam | PF07716 | Basic region leucine zipper | 18 | 68 | 1.0E-12 |
| 12 | g14853.t1 | ProSiteProfiles | PS50217 | Basic-leucine zipper (bZIP) domain profile. | 17 | 80 | 9.841 |
| 7 | g14853.t1 | SMART | SM00338 | brlzneu | 15 | 79 | 1.3E-6 |
| 4 | g14853.t1 | SUPERFAMILY | SSF57959 | Leucine zipper domain | 15 | 79 | 3.69E-17 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006355 | regulation of transcription, DNA-templated | BP |
| GO:0003700 | DNA-binding transcription factor activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
