| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15028 | g15028.t21 | isoform | g15028.t21 | 3588891 | 3590548 |
| chr_4 | g15028 | g15028.t21 | exon | g15028.t21.exon1 | 3588891 | 3589041 |
| chr_4 | g15028 | g15028.t21 | cds | g15028.t21.CDS1 | 3588891 | 3589041 |
| chr_4 | g15028 | g15028.t21 | exon | g15028.t21.exon2 | 3589409 | 3589551 |
| chr_4 | g15028 | g15028.t21 | cds | g15028.t21.CDS2 | 3589409 | 3589536 |
| chr_4 | g15028 | g15028.t21 | exon | g15028.t21.exon3 | 3590541 | 3590548 |
| chr_4 | g15028 | g15028.t21 | TSS | g15028.t21 | 3590713 | 3590713 |
| chr_4 | g15028 | g15028.t21 | TTS | g15028.t21 | NA | NA |
>g15028.t21 Gene=g15028 Length=302
TGAACAAGTTTAATAGAAATATTATGGCACCGTCTGAGAGCAATTGTAATGGTGAATTAA
AAACGCGTCTGAGACGAACACAAAGCGTAACACGTGCTGAAGAGATCACTGATCAAGAGC
AAAAGCAAAGAAAGAGTCAACCAGATAAACCAGTACACAAGCCACGAGATTCTCTTTTTT
CGTGGAGTTCAAATTTCAATGATTTTAGTGGTTTGGTGAATTGGGGATTTCTTTTATTGA
CAATGGGAGGCATCAGATTGCTACTAGAAAATTTTATAAAATATGGATTTCGAGTTGATC
CA
>g15028.t21 Gene=g15028 Length=93
MAPSESNCNGELKTRLRRTQSVTRAEEITDQEQKQRKSQPDKPVHKPRDSLFSWSSNFND
FSGLVNWGFLLLTMGGIRLLLENFIKYGFRVDP
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 3 | g15028.t21 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 47 | - |
| 4 | g15028.t21 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 16 | - |
| 2 | g15028.t21 | MobiDBLite | mobidb-lite | consensus disorder prediction | 17 | 47 | - |
| 6 | g15028.t21 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 60 | - |
| 7 | g15028.t21 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 61 | 81 | - |
| 5 | g15028.t21 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 82 | 93 | - |
| 1 | g15028.t21 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 64 | 81 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.