Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Delta(9)-fatty-acid desaturase fat-7.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_4 g15057 g15057.t18 isoform g15057.t18 3735541 3736102
chr_4 g15057 g15057.t18 exon g15057.t18.exon1 3735541 3735781
chr_4 g15057 g15057.t18 cds g15057.t18.CDS1 3735543 3735781
chr_4 g15057 g15057.t18 exon g15057.t18.exon2 3735871 3736009
chr_4 g15057 g15057.t18 cds g15057.t18.CDS2 3735871 3736009
chr_4 g15057 g15057.t18 exon g15057.t18.exon3 3736067 3736102
chr_4 g15057 g15057.t18 cds g15057.t18.CDS3 3736067 3736102
chr_4 g15057 g15057.t18 TSS g15057.t18 NA NA
chr_4 g15057 g15057.t18 TTS g15057.t18 NA NA

Sequences

>g15057.t18 Gene=g15057 Length=416
ATGTCATCGTTTTCATCAAATGACACACTTGGCTTGACAAAAAATGTGAACTCATTATTT
CATATAAAACCTTTTAAAACGGAAATTGTTTGGCGCAATGTTATCATCTTTACCATCATA
CATTATTTAGCACTCAATGCATTTACTATGTGGGATTTTAGAGTTTTTGCATTTCATTAC
ATCTACGGTTGGGTTGGAGCATTTGGAATTTCTGCTGGTGCACATCGTTTATGGTGTCAT
CGAAGTTACAAAGCAAATAAGAAACTTGAATTGCTTCTACTTTATCTAAACACAATAGCA
GTTCAAAATTCAGTCATTGAATGGGTTCGTGATCATCGAGTTCATCACAAACATAGCGAT
ACTGATGCAGATCCTCATAATTCTAAACGTGGATTTTTCTTTTCTCATATGGGCTG

>g15057.t18 Gene=g15057 Length=138
MSSFSSNDTLGLTKNVNSLFHIKPFKTEIVWRNVIIFTIIHYLALNAFTMWDFRVFAFHY
IYGWVGAFGISAGAHRLWCHRSYKANKKLELLLLYLNTIAVQNSVIEWVRDHRVHHKHSD
TDADPHNSKRGFFFSHMG

Protein features from InterProScan

Transcript Database ID Name Start End E.value
1 g15057.t18 PANTHER PTHR11351 ACYL-COA DESATURASE 24 138 3.9E-44
2 g15057.t18 PANTHER PTHR11351:SF31 RE43130P 24 138 3.9E-44
3 g15057.t18 PRINTS PR00075 Fatty acid desaturase family 1 signature 31 51 2.3E-24
4 g15057.t18 PRINTS PR00075 Fatty acid desaturase family 1 signature 75 95 2.3E-24
5 g15057.t18 PRINTS PR00075 Fatty acid desaturase family 1 signature 112 138 2.3E-24
9 g15057.t18 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 28 -
11 g15057.t18 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 29 51 -
10 g15057.t18 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 52 56 -
12 g15057.t18 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 57 78 -
8 g15057.t18 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 79 138 -
6 g15057.t18 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 29 51 -
7 g15057.t18 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 56 78 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0055114 NA NA
GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed