| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15057 | g15057.t18 | isoform | g15057.t18 | 3735541 | 3736102 |
| chr_4 | g15057 | g15057.t18 | exon | g15057.t18.exon1 | 3735541 | 3735781 |
| chr_4 | g15057 | g15057.t18 | cds | g15057.t18.CDS1 | 3735543 | 3735781 |
| chr_4 | g15057 | g15057.t18 | exon | g15057.t18.exon2 | 3735871 | 3736009 |
| chr_4 | g15057 | g15057.t18 | cds | g15057.t18.CDS2 | 3735871 | 3736009 |
| chr_4 | g15057 | g15057.t18 | exon | g15057.t18.exon3 | 3736067 | 3736102 |
| chr_4 | g15057 | g15057.t18 | cds | g15057.t18.CDS3 | 3736067 | 3736102 |
| chr_4 | g15057 | g15057.t18 | TSS | g15057.t18 | NA | NA |
| chr_4 | g15057 | g15057.t18 | TTS | g15057.t18 | NA | NA |
>g15057.t18 Gene=g15057 Length=416
ATGTCATCGTTTTCATCAAATGACACACTTGGCTTGACAAAAAATGTGAACTCATTATTT
CATATAAAACCTTTTAAAACGGAAATTGTTTGGCGCAATGTTATCATCTTTACCATCATA
CATTATTTAGCACTCAATGCATTTACTATGTGGGATTTTAGAGTTTTTGCATTTCATTAC
ATCTACGGTTGGGTTGGAGCATTTGGAATTTCTGCTGGTGCACATCGTTTATGGTGTCAT
CGAAGTTACAAAGCAAATAAGAAACTTGAATTGCTTCTACTTTATCTAAACACAATAGCA
GTTCAAAATTCAGTCATTGAATGGGTTCGTGATCATCGAGTTCATCACAAACATAGCGAT
ACTGATGCAGATCCTCATAATTCTAAACGTGGATTTTTCTTTTCTCATATGGGCTG
>g15057.t18 Gene=g15057 Length=138
MSSFSSNDTLGLTKNVNSLFHIKPFKTEIVWRNVIIFTIIHYLALNAFTMWDFRVFAFHY
IYGWVGAFGISAGAHRLWCHRSYKANKKLELLLLYLNTIAVQNSVIEWVRDHRVHHKHSD
TDADPHNSKRGFFFSHMG
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g15057.t18 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 24 | 138 | 3.9E-44 |
| 2 | g15057.t18 | PANTHER | PTHR11351:SF31 | RE43130P | 24 | 138 | 3.9E-44 |
| 3 | g15057.t18 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 31 | 51 | 2.3E-24 |
| 4 | g15057.t18 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 75 | 95 | 2.3E-24 |
| 5 | g15057.t18 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 112 | 138 | 2.3E-24 |
| 9 | g15057.t18 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 28 | - |
| 11 | g15057.t18 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 29 | 51 | - |
| 10 | g15057.t18 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 52 | 56 | - |
| 12 | g15057.t18 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 57 | 78 | - |
| 8 | g15057.t18 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 79 | 138 | - |
| 6 | g15057.t18 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 29 | 51 | - |
| 7 | g15057.t18 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 56 | 78 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed