| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15057 | g15057.t5 | TTS | g15057.t5 | 3734473 | 3734473 |
| chr_4 | g15057 | g15057.t5 | isoform | g15057.t5 | 3734658 | 3735994 |
| chr_4 | g15057 | g15057.t5 | exon | g15057.t5.exon1 | 3734658 | 3734722 |
| chr_4 | g15057 | g15057.t5 | exon | g15057.t5.exon2 | 3734780 | 3735043 |
| chr_4 | g15057 | g15057.t5 | cds | g15057.t5.CDS1 | 3735034 | 3735043 |
| chr_4 | g15057 | g15057.t5 | exon | g15057.t5.exon3 | 3735541 | 3735781 |
| chr_4 | g15057 | g15057.t5 | cds | g15057.t5.CDS2 | 3735541 | 3735781 |
| chr_4 | g15057 | g15057.t5 | exon | g15057.t5.exon4 | 3735871 | 3735994 |
| chr_4 | g15057 | g15057.t5 | cds | g15057.t5.CDS3 | 3735871 | 3735898 |
| chr_4 | g15057 | g15057.t5 | TSS | g15057.t5 | NA | NA |
>g15057.t5 Gene=g15057 Length=694
TCATTATTTCATATAAAACCTTTTAAAACGGAAATTGTTTGGCGCAATGTTATCATCTTT
ACCATCATACATTATTTAGCACTCAATGCATTTACTATGTGGGATTTTAGAGTTTTTGCA
TTTCATTACATCTACGGTTGGGTTGGAGCATTTGGAATTTCTGCTGGTGCACATCGTTTA
TGGTGTCATCGAAGTTACAAAGCAAATAAGAAACTTGAATTGCTTCTACTTTATCTAAAC
ACAATAGCAGTTCAAAATTCAGTCATTGAATGGGTTCGTGATCATCGAGTTCATCACAAA
CATAGCGATACTGATGCAGATCCTCATAATTCTAAACGTGGATTTTTCTTTTCTCATATG
GGCTGGCTGGCATAATTTCCACCATGTCTTTCCATGGGATTACAAAGTTTCAGAACTTCC
ACTCTATCGCTACAACTTCACAATCGCTTTTATTGACTTCTTTGTATGGCTTGGATGGGC
AACAGACCTAAAAGTAGCATCTGACGATATGATCAGAAAAAGAGTTCTCAGAACTGGTGA
TGGAAGTCATCCATATTCAATTGAAGCTGCTAAAAACAAAATTGAATTTGATATTGCGCA
AAATGTGTCAAGTTTATGTTGGGGATTGGGCGACAATGATATGACTGAAGATGAAATGAA
TGGAATAAAAACACTACACCCAAAAAGTCAATAA
>g15057.t5 Gene=g15057 Length=92
MWDFRVFAFHYIYGWVGAFGISAGAHRLWCHRSYKANKKLELLLLYLNTIAVQNSVIEWV
RDHRVHHKHSDTDADPHNSKRGFFFSHMGWLA
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g15057.t5 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 5 | 91 | 7.0E-39 |
| 2 | g15057.t5 | PANTHER | PTHR11351:SF31 | RE43130P | 5 | 91 | 7.0E-39 |
| 5 | g15057.t5 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 3 | 25 | 6.0E-25 |
| 4 | g15057.t5 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 26 | 46 | 6.0E-25 |
| 3 | g15057.t5 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 63 | 92 | 6.0E-25 |
| 8 | g15057.t5 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 11 | - |
| 9 | g15057.t5 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 30 | - |
| 7 | g15057.t5 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 31 | 92 | - |
| 6 | g15057.t5 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 29 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
## Warning: Removed 1 row(s) containing missing values (geom_path).
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed