| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15058 | g15058.t1 | isoform | g15058.t1 | 3738648 | 3744272 |
| chr_4 | g15058 | g15058.t1 | exon | g15058.t1.exon1 | 3738648 | 3738940 |
| chr_4 | g15058 | g15058.t1 | cds | g15058.t1.CDS1 | 3738648 | 3738940 |
| chr_4 | g15058 | g15058.t1 | exon | g15058.t1.exon2 | 3739006 | 3739241 |
| chr_4 | g15058 | g15058.t1 | cds | g15058.t1.CDS2 | 3739006 | 3739241 |
| chr_4 | g15058 | g15058.t1 | exon | g15058.t1.exon3 | 3739296 | 3739632 |
| chr_4 | g15058 | g15058.t1 | cds | g15058.t1.CDS3 | 3739296 | 3739632 |
| chr_4 | g15058 | g15058.t1 | exon | g15058.t1.exon4 | 3744128 | 3744272 |
| chr_4 | g15058 | g15058.t1 | cds | g15058.t1.CDS4 | 3744128 | 3744272 |
| chr_4 | g15058 | g15058.t1 | TSS | g15058.t1 | NA | NA |
| chr_4 | g15058 | g15058.t1 | TTS | g15058.t1 | NA | NA |
>g15058.t1 Gene=g15058 Length=1011
ATGATTCTTGGAAAAAGTGAAATAGAAAAAAGTGAAAAACCATTTAAAAAAGAAATTGTG
TGGCGAAATGTATTTTTATTTTCCTTAATTCATTTAATGGCTTTAAATGTTTATTTTCAC
TGGAATTGGAATGGATTTTTATTTCATTTTTTCTACGGACTTTTCTCAGCTTTTGGAATT
TCAGCTGGTGCACATCGTTTATGGTCTCATCGAAGTTACAAAGCAAATTTTAAACTTCAA
GTTTTGCTTATGATTATGCAAACAATCTGCATTGAAAATGACGTCATTGAATGGGTTCGT
GATCATCGAGTTCATCATAAATTCAGTGATACTGATGCAGATCCTCATAATTCACAACGT
GGTTTATTTTTCTCTCATATGGGCTGGTTATTGTGCAAAAAGCATCCTGATGTGCGAAAG
TATGGTTCAAAAGTTGATATGAGCGATATTGAGTCAGAGCCAGTGTTGAAATTTCAAAGA
AAATTTTACATTCCACTTGTGCTGATTTTTTCTTTCATCATTCCAATAAAAATTTCAATG
TATCTTGTTGGTCATGATTTGATGGTTGGAATTTGTGCAATATTTTGTCGATATGTTATT
TCATTGCATCTTGTATGGTTTACAAATTCTTTTGCTCATGTTGGAAGTTGGAAGCCTTAT
GATAAAAATATTGCACCAAGTGATTCGAAATTTTTTGGAATAATTTGCTTTGGTGAAGGC
TGGCATAATTTCCACCATGTCTTTCCATGGGATTACAAAGTTTCAGAACTTCCACTCTAT
CGCTACAACTTCACAATCGCTTTCATTGACTTCTTTTCATGGCTTGGATGGGCAACAGAC
CTAAAAATCGCATCAGACGATATGATAAAAGCAAGAGTCTTGCGAACAGGTGATGGAAGT
CATCCATATTCAATGAAGTCAACGAGAAAGGTGAAGAAACTTGATGAAAACTGCAACATT
GTGGAATTCATGAAAAGTGATGAGTCGTATTGGGGATTAGGTATGAAATAA
>g15058.t1 Gene=g15058 Length=336
MILGKSEIEKSEKPFKKEIVWRNVFLFSLIHLMALNVYFHWNWNGFLFHFFYGLFSAFGI
SAGAHRLWSHRSYKANFKLQVLLMIMQTICIENDVIEWVRDHRVHHKFSDTDADPHNSQR
GLFFSHMGWLLCKKHPDVRKYGSKVDMSDIESEPVLKFQRKFYIPLVLIFSFIIPIKISM
YLVGHDLMVGICAIFCRYVISLHLVWFTNSFAHVGSWKPYDKNIAPSDSKFFGIICFGEG
WHNFHHVFPWDYKVSELPLYRYNFTIAFIDFFSWLGWATDLKIASDDMIKARVLRTGDGS
HPYSMKSTRKVKKLDENCNIVEFMKSDESYWGLGMK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 23 | g15058.t1 | CDD | cd03505 | Delta9-FADS-like | 42 | 282 | 1.29656E-65 |
| 2 | g15058.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 9 | 312 | 2.1E-111 |
| 3 | g15058.t1 | PANTHER | PTHR11351:SF31 | RE43130P | 9 | 312 | 2.1E-111 |
| 7 | g15058.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 21 | 41 | 2.0E-46 |
| 8 | g15058.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 65 | 85 | 2.0E-46 |
| 6 | g15058.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 102 | 131 | 2.0E-46 |
| 5 | g15058.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 163 | 181 | 2.0E-46 |
| 9 | g15058.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 195 | 216 | 2.0E-46 |
| 4 | g15058.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 238 | 252 | 2.0E-46 |
| 1 | g15058.t1 | Pfam | PF00487 | Fatty acid desaturase | 43 | 261 | 2.6E-12 |
| 15 | g15058.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 19 | - |
| 20 | g15058.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 41 | - |
| 18 | g15058.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 42 | 46 | - |
| 22 | g15058.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 47 | 68 | - |
| 16 | g15058.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 69 | 161 | - |
| 21 | g15058.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 162 | 182 | - |
| 17 | g15058.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 183 | 187 | - |
| 19 | g15058.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 188 | 208 | - |
| 14 | g15058.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 209 | 336 | - |
| 10 | g15058.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 19 | 41 | - |
| 12 | g15058.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 46 | 68 | - |
| 13 | g15058.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 162 | 184 | - |
| 11 | g15058.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 188 | 207 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed