General information for g15098.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g15098 is located on chr_4: 3901333..3901920 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15098 | g15098.t1 | TTS | g15098.t1 | 3900386 | 3900386 |
| chr_4 | g15098 | g15098.t1 | isoform | g15098.t1 | 3901333 | 3901920 |
| chr_4 | g15098 | g15098.t1 | exon | g15098.t1.exon1 | 3901333 | 3901521 |
| chr_4 | g15098 | g15098.t1 | cds | g15098.t1.CDS1 | 3901333 | 3901521 |
| chr_4 | g15098 | g15098.t1 | exon | g15098.t1.exon2 | 3901852 | 3901920 |
| chr_4 | g15098 | g15098.t1 | cds | g15098.t1.CDS2 | 3901852 | 3901920 |
| chr_4 | g15098 | g15098.t1 | TSS | g15098.t1 | 3901999 | 3901999 |
Sequences
>g15098.t1 Gene=g15098 Length=258
ATGGGAAATTTATGTGGATCGTGCTTTAAAGGAACTGCTGATGCAAGTGATCTTTTAACA
CCAGATGCTGAAACACGAAGGAGACAAATGGCAGAAGCAGCAGAACGACGACAACAAGAA
CAATCAAATAGAGGAATCAAAAATCCAGAAAGTGTAAAAAGAATGCAAAATAAATCGCAA
GAAACAGAACGACTGGAACGTGAAAGAGCAATGGCTGGATCTGGTGGACAACCAAATTTA
AAATGGACACAAGGATAA
>g15098.t1 Gene=g15098 Length=85
MGNLCGSCFKGTADASDLLTPDAETRRRQMAEAAERRQQEQSNRGIKNPESVKRMQNKSQ
ETERLERERAMAGSGGQPNLKWTQG
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g15098.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 85 | - |
| 3 | g15098.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 20 | 43 | - |
| 5 | g15098.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 54 | 70 | - |
| 2 | g15098.t1 | PANTHER | PTHR35269 | SMALL VCP/P97-INTERACTING PROTEIN | 2 | 84 | 1.8E-23 |
| 1 | g15098.t1 | Pfam | PF15811 | Small VCP/p97-interacting protein | 1 | 81 | 3.7E-26 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K14014 (small VCP/p97-interacting protein)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
