General information for g15132.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Transmembrane emp24 domain-containing protein 1.
Parent gene
- The parent gene g15132 is located on chr_4: 4057189..4058048 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15132 | g15132.t1 | TTS | g15132.t1 | 4056888 | 4056888 |
| chr_4 | g15132 | g15132.t1 | isoform | g15132.t1 | 4057189 | 4058048 |
| chr_4 | g15132 | g15132.t1 | exon | g15132.t1.exon1 | 4057189 | 4057743 |
| chr_4 | g15132 | g15132.t1 | cds | g15132.t1.CDS1 | 4057189 | 4057743 |
| chr_4 | g15132 | g15132.t1 | exon | g15132.t1.exon2 | 4057887 | 4058048 |
| chr_4 | g15132 | g15132.t1 | cds | g15132.t1.CDS2 | 4057887 | 4058048 |
| chr_4 | g15132 | g15132.t1 | TSS | g15132.t1 | 4058166 | 4058166 |
Sequences
>g15132.t1 Gene=g15132 Length=717
ATGAAGCAATTCATATTATTGACAATTTTTGCTTTCATATCAGAGAATCTCATGACAGTC
GAATGTTTAGATAAAGAAATGACAATTGTTGTTAATGCTAAAGAAAAAGAATGCTTTTAT
GAGCGCGTTCCTGAGAATTTTATCATTGATATTGAATATCAGGTAATTGATGGAGGACAA
GGTGATCTTGACATTAACTTCGAACTTTCAGTCAATAATCGAATAATTTTTGCTGACCAT
AAAAAATCAGACAATATTCATCGACTTGATAAGCCACATCCAGAAGCTGACTATATGTTT
TGCTTTGACAACACAATCAGTCATTTCAATACTAAAACAGTCTTTTTTGAACTTATAATT
GAAGATCCAAATAATCCAGTTGATGAAAATGATGTGATTTCTGATTTAGAAGGACTTTCA
CCTGAAGAATTTTATGAAATGAAAGTTCAGGATATTCAAGATATTATTCATAATGTTAAG
ACAAAAATCAACAAAGCTCGACAATTGCAAGACATGCTGAGAAGTTTTGAAGCAAGAGAC
AGAAATTTGGCTGAACTTAATTGCAGTCGTGTTAATTGGTTGAGTTTTTTCATTGTGTCA
TTGATGATTGTTGTAGGATTGATTCAAGTTTACATGATAAGAAGTTTATTTGACACCGAT
CCAAAAGGAAGAAGAATTTGGCAAAAAATTAATAGTATTGTTGATAAACTTAAGTAA
>g15132.t1 Gene=g15132 Length=238
MKQFILLTIFAFISENLMTVECLDKEMTIVVNAKEKECFYERVPENFIIDIEYQVIDGGQ
GDLDINFELSVNNRIIFADHKKSDNIHRLDKPHPEADYMFCFDNTISHFNTKTVFFELII
EDPNNPVDENDVISDLEGLSPEEFYEMKVQDIQDIIHNVKTKINKARQLQDMLRSFEARD
RNLAELNCSRVNWLSFFIVSLMIVVGLIQVYMIRSLFDTDPKGRRIWQKINSIVDKLK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g15132.t1 | Coils | Coil | Coil | 159 | 179 | - |
| 2 | g15132.t1 | PANTHER | PTHR22811 | TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEIN | 5 | 225 | 2.1E-69 |
| 3 | g15132.t1 | PANTHER | PTHR22811:SF59 | OPOSSUM, ISOFORM A | 5 | 225 | 2.1E-69 |
| 1 | g15132.t1 | Pfam | PF01105 | emp24/gp25L/p24 family/GOLD | 27 | 217 | 3.6E-37 |
| 9 | g15132.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 22 | - |
| 10 | g15132.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 3 | - |
| 11 | g15132.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 4 | 14 | - |
| 13 | g15132.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 15 | 22 | - |
| 8 | g15132.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 23 | 192 | - |
| 12 | g15132.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 193 | 217 | - |
| 7 | g15132.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 218 | 238 | - |
| 16 | g15132.t1 | ProSiteProfiles | PS50866 | GOLD domain profile. | 36 | 120 | 16.244 |
| 15 | g15132.t1 | SMART | SM01190 | EMP24_GP25L_2 | 26 | 218 | 8.2E-45 |
| 4 | g15132.t1 | SUPERFAMILY | SSF101576 | Supernatant protein factor (SPF), C-terminal domain | 35 | 125 | 1.31E-16 |
| 5 | g15132.t1 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 22 | - |
| 14 | g15132.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 213 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K14825 (p24 family protein gamma-2)
Pathway
This gene does not belong to any pathways.
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
