Gene loci information

Transcript annotation

  • This transcript has been not been annotated.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_4 g15152 g15152.t1 isoform g15152.t1 4142347 4142606
chr_4 g15152 g15152.t1 exon g15152.t1.exon1 4142347 4142353
chr_4 g15152 g15152.t1 cds g15152.t1.CDS1 4142347 4142353
chr_4 g15152 g15152.t1 exon g15152.t1.exon2 4142413 4142606
chr_4 g15152 g15152.t1 cds g15152.t1.CDS2 4142413 4142606
chr_4 g15152 g15152.t1 TTS g15152.t1 4142669 4142669
chr_4 g15152 g15152.t1 TSS g15152.t1 NA NA

Sequences

>g15152.t1 Gene=g15152 Length=201
ATGCAAAAGAACAAAATGACAAACATGCAACACTATCATGAACTCTTCAATCAACTTTCG
AATGACAATAAGCCAACTGATAAATTCATTCGCAAGGGAATTGTTGGAGATCATAAGAAT
GCAATGAGTGAAGAAACCATCAAGAGATTCGATGAATGGTGGGCACAAAGAACAACACTT
AAACCTGGATACAACAAATAA

>g15152.t1 Gene=g15152 Length=66
MQKNKMTNMQHYHELFNQLSNDNKPTDKFIRKGIVGDHKNAMSEETIKRFDEWWAQRTTL
KPGYNK

Protein features from InterProScan

Transcript Database ID Name Start End E.value
3 g15152.t1 Gene3D G3DSA:3.40.50.300 - 1 61 0e+00
1 g15152.t1 Pfam PF00685 Sulfotransferase domain 1 57 5e-06
2 g15152.t1 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases 1 58 3e-07

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0008146 sulfotransferase activity MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed