General information for g15152.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g15152 is located on chr_4: 4142347..4142606 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15152 | g15152.t1 | isoform | g15152.t1 | 4142347 | 4142606 |
| chr_4 | g15152 | g15152.t1 | exon | g15152.t1.exon1 | 4142347 | 4142353 |
| chr_4 | g15152 | g15152.t1 | cds | g15152.t1.CDS1 | 4142347 | 4142353 |
| chr_4 | g15152 | g15152.t1 | exon | g15152.t1.exon2 | 4142413 | 4142606 |
| chr_4 | g15152 | g15152.t1 | cds | g15152.t1.CDS2 | 4142413 | 4142606 |
| chr_4 | g15152 | g15152.t1 | TTS | g15152.t1 | 4142669 | 4142669 |
| chr_4 | g15152 | g15152.t1 | TSS | g15152.t1 | NA | NA |
Sequences
>g15152.t1 Gene=g15152 Length=201
ATGCAAAAGAACAAAATGACAAACATGCAACACTATCATGAACTCTTCAATCAACTTTCG
AATGACAATAAGCCAACTGATAAATTCATTCGCAAGGGAATTGTTGGAGATCATAAGAAT
GCAATGAGTGAAGAAACCATCAAGAGATTCGATGAATGGTGGGCACAAAGAACAACACTT
AAACCTGGATACAACAAATAA
>g15152.t1 Gene=g15152 Length=66
MQKNKMTNMQHYHELFNQLSNDNKPTDKFIRKGIVGDHKNAMSEETIKRFDEWWAQRTTL
KPGYNK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 3 | g15152.t1 | Gene3D | G3DSA:3.40.50.300 | - | 1 | 61 | 0e+00 |
| 1 | g15152.t1 | Pfam | PF00685 | Sulfotransferase domain | 1 | 57 | 5e-06 |
| 2 | g15152.t1 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 1 | 58 | 3e-07 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0008146 | sulfotransferase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed