General information for g15163.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Probable cytochrome P450 305a1.
Parent gene
- The parent gene g15163 is located on chr_4: 4191595..4193561 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15163 | g15163.t1 | TSS | g15163.t1 | 4191437 | 4191437 |
| chr_4 | g15163 | g15163.t1 | isoform | g15163.t1 | 4191595 | 4193561 |
| chr_4 | g15163 | g15163.t1 | exon | g15163.t1.exon1 | 4191595 | 4191694 |
| chr_4 | g15163 | g15163.t1 | cds | g15163.t1.CDS1 | 4191595 | 4191694 |
| chr_4 | g15163 | g15163.t1 | exon | g15163.t1.exon2 | 4193347 | 4193561 |
| chr_4 | g15163 | g15163.t1 | cds | g15163.t1.CDS2 | 4193347 | 4193561 |
| chr_4 | g15163 | g15163.t1 | TTS | g15163.t1 | NA | NA |
Sequences
>g15163.t1 Gene=g15163 Length=315
ATGTTGGAAATATTTCTTGCTTCTATTGCCTTAATTTTTGTCATTAGGGCAATTAGTGCA
ATTTTAAAAGAATTTAGACGACCTGAAAACTTCCCACCAGGACCTAACTGGTTTTTACCA
TTTGTCGGCAGTTCAAGATACTTTAAAAAATTATGTCAACTATTTGGGGGACAACACAAA
GCTTTTCTTTACCTGGCAAAGAAATACAACTCACCAATTTTTAGTATCAAACTTGGAAGG
GAACTTGTGGTTGTTGTTACAACTTATGAATTGATAAAGGAAGTCCATGCAAGAGAAGAA
TTTGATGGACGGTAA
>g15163.t1 Gene=g15163 Length=104
MLEIFLASIALIFVIRAISAILKEFRRPENFPPGPNWFLPFVGSSRYFKKLCQLFGGQHK
AFLYLAKKYNSPIFSIKLGRELVVVVTTYELIKEVHAREEFDGR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g15163.t1 | Gene3D | G3DSA:1.10.630.10 | Cytochrome p450 | 22 | 104 | 1.2E-10 |
| 2 | g15163.t1 | PANTHER | PTHR24303:SF13 | CYTOCHROME P450 305A1-RELATED | 9 | 104 | 5.0E-21 |
| 3 | g15163.t1 | PANTHER | PTHR24303 | HEME-BINDING MONOOXYGENASE FAMILY | 9 | 104 | 5.0E-21 |
| 1 | g15163.t1 | Pfam | PF00067 | Cytochrome P450 | 32 | 102 | 1.6E-7 |
| 8 | g15163.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 19 | - |
| 9 | g15163.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 3 | - |
| 10 | g15163.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 4 | 15 | - |
| 11 | g15163.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 16 | 19 | - |
| 7 | g15163.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 20 | 104 | - |
| 5 | g15163.t1 | SUPERFAMILY | SSF48264 | Cytochrome P450 | 25 | 99 | 2.23E-11 |
| 4 | g15163.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 4 | 22 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0020037 | heme binding | MF |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | MF |
| GO:0005506 | iron ion binding | MF |
| GO:0055114 | NA | NA |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed