General information for g15361.t1
Yuki Yoshida
6/2/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g15361 is located on chr_4: 5112474..5112752 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15361 | g15361.t1 | TTS | g15361.t1 | 5112302 | 5112302 |
| chr_4 | g15361 | g15361.t1 | isoform | g15361.t1 | 5112474 | 5112752 |
| chr_4 | g15361 | g15361.t1 | exon | g15361.t1.exon1 | 5112474 | 5112631 |
| chr_4 | g15361 | g15361.t1 | cds | g15361.t1.CDS1 | 5112474 | 5112631 |
| chr_4 | g15361 | g15361.t1 | exon | g15361.t1.exon2 | 5112710 | 5112752 |
| chr_4 | g15361 | g15361.t1 | cds | g15361.t1.CDS2 | 5112710 | 5112752 |
| chr_4 | g15361 | g15361.t1 | TSS | g15361.t1 | 5112827 | 5112827 |
Sequences
>g15361.t1 Gene=g15361 Length=201
ATGTCTTCAACACTTTTATTGGGAAAATTAGCATTTGTGACAGGAGCTGGAAGCGGAATT
GGACGAGCGACAGCAATTCGTTTTGCTCAAGAAGGAGCAACAGTCATTGCTGCAGATAGA
AATTTTAAACAAGCTGAAGAAACTGCCAAAAAACTTGGAGGTAAGAAAATAAAATTTTTA
ATAATCATTGAATGTGAGTGA
>g15361.t1 Gene=g15361 Length=66
MSSTLLLGKLAFVTGAGSGIGRATAIRFAQEGATVIAADRNFKQAEETAKKLGGKKIKFL
IIIECE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g15361.t1 | CDD | cd05233 | SDR_c | 11 | 60 | 3.73906E-14 |
| 5 | g15361.t1 | Gene3D | G3DSA:3.40.50.720 | - | 2 | 62 | 1.9E-16 |
| 2 | g15361.t1 | PANTHER | PTHR43391:SF12 | OXIDOREDUCTASE EPHD-RELATED | 8 | 55 | 4.2E-13 |
| 3 | g15361.t1 | PANTHER | PTHR43391 | RETINOL DEHYDROGENASE-RELATED | 8 | 55 | 4.2E-13 |
| 1 | g15361.t1 | Pfam | PF00106 | short chain dehydrogenase | 9 | 60 | 3.7E-12 |
| 7 | g15361.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 23 | - |
| 8 | g15361.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 3 | - |
| 9 | g15361.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 4 | 15 | - |
| 10 | g15361.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 16 | 23 | - |
| 6 | g15361.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 24 | 66 | - |
| 4 | g15361.t1 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains | 6 | 60 | 4.34E-17 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
## [1] "No matching GO terms"KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
