General information for g15555.t4
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Zinc finger and BTB domain-containing protein 24.
Parent gene
- The parent gene g15555 is located on chr_4: 5842356..5843171 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15555 | g15555.t4 | isoform | g15555.t4 | 5842356 | 5843171 |
| chr_4 | g15555 | g15555.t4 | exon | g15555.t4.exon1 | 5842356 | 5842952 |
| chr_4 | g15555 | g15555.t4 | cds | g15555.t4.CDS1 | 5842551 | 5842952 |
| chr_4 | g15555 | g15555.t4 | TSS | g15555.t4 | 5842701 | 5842701 |
| chr_4 | g15555 | g15555.t4 | exon | g15555.t4.exon2 | 5843010 | 5843171 |
| chr_4 | g15555 | g15555.t4 | cds | g15555.t4.CDS2 | 5843010 | 5843171 |
| chr_4 | g15555 | g15555.t4 | TTS | g15555.t4 | 5843206 | 5843206 |
Sequences
>g15555.t4 Gene=g15555 Length=759
TGTAATCATTTCAGTATAAATTCAATATTTTTTAAACTTTCAAAGAATTTTAAATATTTA
AATTTACATTCAAAAATTATTCAAAAATCTTCATTCCAGGATCCAGCACGTGAAATAATA
ATCGATGCACCAATCAGCTATTCTTGTGCTAAATGTAAATCAAAATTTCCAACATTTGAA
GCACTCACAGCTCACATGAAAGCAAAAGATTGCCAAGATGAAGAATTTTCATGTAATATT
TGCAGTAAAGTTTTCAAGAATAAAAAGAATCTTTATGCTCATATGGCAACCCATAAACCA
AAAGAGAAATTCATTTGTGAAGTTTGTGCAAAGGAATATAATCATCAATTTGATCTAGAG
TCACATATGGAAAGTGTTCATCATCGTGTTGTCAAAAGAGACTGCATTTATAGATGCACT
CATTGTGAAGAGAAATTTAATTCACATTTGGACTTATTAGAGCATGTCAAAGAACATCAA
AGAGAGAAAAAAGAAGCGCCAAGATTGTGTGAAATTTGTGCAAAAGTTTGTGCTAATTTA
AAGGCTTATCAATCACATATTGTTATTCATAAAGAGAAGAAAGCTCATACTTGTATTCAT
TGTGGTAAAGGATTTGCAAAAGCATTTTTAATGACACAACATATGCACATTCATACAGGC
ATCAAAGGATTTACATGCGATATTTGTAATAAAAGTTATGCAAAAAGAGATTCATTAAGA
ATTCACAAGAAAAGAGATCATCCTGAATTAATGATGTAA
>g15555.t4 Gene=g15555 Length=187
MKAKDCQDEEFSCNICSKVFKNKKNLYAHMATHKPKEKFICEVCAKEYNHQFDLESHMES
VHHRVVKRDCIYRCTHCEEKFNSHLDLLEHVKEHQREKKEAPRLCEICAKVCANLKAYQS
HIVIHKEKKAHTCIHCGKGFAKAFLMTQHMHIHTGIKGFTCDICNKSYAKRDSLRIHKKR
DHPELMM
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 19 | g15555.t4 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 1 | 65 | 5.0E-13 |
| 22 | g15555.t4 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 67 | 129 | 4.0E-7 |
| 21 | g15555.t4 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 130 | 157 | 3.6E-7 |
| 20 | g15555.t4 | Gene3D | G3DSA:3.30.160.60 | Classic Zinc Finger | 158 | 185 | 9.2E-9 |
| 5 | g15555.t4 | PANTHER | PTHR24406 | TRANSCRIPTIONAL REPRESSOR CTCFL-RELATED | 4 | 183 | 1.3E-31 |
| 3 | g15555.t4 | Pfam | PF00096 | Zinc finger, C2H2 type | 11 | 33 | 2.0E-6 |
| 4 | g15555.t4 | Pfam | PF00096 | Zinc finger, C2H2 type | 39 | 62 | 0.0047 |
| 1 | g15555.t4 | Pfam | PF12874 | Zinc-finger of C2H2 type | 105 | 124 | 0.052 |
| 2 | g15555.t4 | Pfam | PF13912 | C2H2-type zinc finger | 159 | 183 | 7.9E-5 |
| 15 | g15555.t4 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 13 | 33 | - |
| 17 | g15555.t4 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 74 | 94 | - |
| 18 | g15555.t4 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 133 | 153 | - |
| 16 | g15555.t4 | ProSitePatterns | PS00028 | Zinc finger C2H2 type domain signature. | 161 | 182 | - |
| 26 | g15555.t4 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 11 | 38 | 11.448 |
| 27 | g15555.t4 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 39 | 62 | 9.494 |
| 25 | g15555.t4 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 72 | 99 | 11.614 |
| 24 | g15555.t4 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 131 | 158 | 11.822 |
| 23 | g15555.t4 | ProSiteProfiles | PS50157 | Zinc finger C2H2 type domain profile. | 159 | 182 | 10.201 |
| 12 | g15555.t4 | SMART | SM00355 | c2h2final6 | 11 | 33 | 2.3E-4 |
| 14 | g15555.t4 | SMART | SM00355 | c2h2final6 | 39 | 62 | 0.012 |
| 13 | g15555.t4 | SMART | SM00355 | c2h2final6 | 72 | 94 | 0.0022 |
| 11 | g15555.t4 | SMART | SM00355 | c2h2final6 | 103 | 125 | 1.9 |
| 10 | g15555.t4 | SMART | SM00355 | c2h2final6 | 131 | 153 | 0.22 |
| 9 | g15555.t4 | SMART | SM00355 | c2h2final6 | 159 | 182 | 0.0052 |
| 8 | g15555.t4 | SUPERFAMILY | SSF57667 | beta-beta-alpha zinc fingers | 11 | 58 | 8.71E-11 |
| 7 | g15555.t4 | SUPERFAMILY | SSF57667 | beta-beta-alpha zinc fingers | 71 | 125 | 2.38E-5 |
| 6 | g15555.t4 | SUPERFAMILY | SSF57667 | beta-beta-alpha zinc fingers | 125 | 177 | 4.38E-13 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
