General information for g1584.t3
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Synaptosomal-associated protein 25.
Parent gene
- The parent gene g1584 is located on chr_3: 12008173..12019235 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g1584 | g1584.t3 | isoform | g1584.t3 | 12004684 | 12016299 |
| chr_3 | g1584 | g1584.t3 | exon | g1584.t3.exon1 | 12004684 | 12004749 |
| chr_3 | g1584 | g1584.t3 | cds | g1584.t3.CDS1 | 12004684 | 12004749 |
| chr_3 | g1584 | g1584.t3 | TTS | g1584.t3 | 12004689 | 12004689 |
| chr_3 | g1584 | g1584.t3 | exon | g1584.t3.exon2 | 12007759 | 12007903 |
| chr_3 | g1584 | g1584.t3 | cds | g1584.t3.CDS2 | 12007759 | 12007903 |
| chr_3 | g1584 | g1584.t3 | exon | g1584.t3.exon3 | 12007981 | 12008109 |
| chr_3 | g1584 | g1584.t3 | cds | g1584.t3.CDS3 | 12007981 | 12008109 |
| chr_3 | g1584 | g1584.t3 | exon | g1584.t3.exon4 | 12008169 | 12008286 |
| chr_3 | g1584 | g1584.t3 | cds | g1584.t3.CDS4 | 12008169 | 12008286 |
| chr_3 | g1584 | g1584.t3 | exon | g1584.t3.exon5 | 12012162 | 12012210 |
| chr_3 | g1584 | g1584.t3 | cds | g1584.t3.CDS5 | 12012162 | 12012210 |
| chr_3 | g1584 | g1584.t3 | exon | g1584.t3.exon6 | 12016106 | 12016147 |
| chr_3 | g1584 | g1584.t3 | cds | g1584.t3.CDS6 | 12016106 | 12016147 |
| chr_3 | g1584 | g1584.t3 | exon | g1584.t3.exon7 | 12016216 | 12016299 |
| chr_3 | g1584 | g1584.t3 | cds | g1584.t3.CDS7 | 12016216 | 12016299 |
| chr_3 | g1584 | g1584.t3 | TSS | g1584.t3 | NA | NA |
Sequences
>g1584.t3 Gene=g1584 Length=633
ATGCCGGCACCAACTGCAGAACCAGCACCTCCACGAACTGAACTGCAAGAATTGCAATTA
AAGGCACAAGAAAAGACCGATGAGTCTCTTGAGTCAACACGTCGAATGTTGGCACTTTGC
GAAGAGAGCAAAGAAGCCGGTATTCGAACATTGGTAGCGCTCGATGATCAGGGAGAACAA
TTGGATCGAATTGAGGAGGGTATGGACCAGATTAATGCTGACATGCGTGAAGCTGAAAAA
AATTTGAGTGGAATGGAAAAATGCTGCGGTATTTGTGTTTTGCCATGTAATAAGAGTGCG
TCATTTAAAGAGGATGATGGAACATGGAAGGGTAATGATGATGGAAAAGTTGTAAACAAT
CAGCCACAACGTGTATGTGACGATCGTAATGGTCTTGGACCGCAAGGAGGTTACATTGGA
CGAATCACAAATGATGCACGTGAAGATGAGATGGAAGAGAATATGGGTCAAGTGAACACA
ATGATTGGTAATTTAAGAAATATGGCACTCGATATGGGTTCAGAGCTCGAAAATCAGAAT
CGTCAAATTGATAGAATCAATCGCAAGGGTGAAATTAATAAAGATAAATTGGATGAAGCT
AGTAAACGTGCTGCAGAACTTTTACGAAAATAA
>g1584.t3 Gene=g1584 Length=210
MPAPTAEPAPPRTELQELQLKAQEKTDESLESTRRMLALCEESKEAGIRTLVALDDQGEQ
LDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSASFKEDDGTWKGNDDGKVVNN
QPQRVCDDRNGLGPQGGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQN
RQIDRINRKGEINKDKLDEASKRAAELLRK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g1584.t3 | CDD | cd15889 | SNARE_SNAP25N_23N | 20 | 84 | 5.82566E-31 |
| 11 | g1584.t3 | CDD | cd15885 | SNARE_SNAP25C | 148 | 206 | 8.4291E-28 |
| 8 | g1584.t3 | Coils | Coil | Coil | 54 | 88 | - |
| 9 | g1584.t3 | Coils | Coil | Coil | 169 | 189 | - |
| 7 | g1584.t3 | Gene3D | G3DSA:1.20.5.110 | - | 5 | 85 | 1.5E-37 |
| 6 | g1584.t3 | Gene3D | G3DSA:1.20.5.110 | - | 125 | 210 | 5.7E-30 |
| 14 | g1584.t3 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 29 | - |
| 2 | g1584.t3 | PANTHER | PTHR19305:SF14 | SYNAPTOSOMAL-ASSOCIATED PROTEIN-RELATED | 9 | 210 | 5.3E-88 |
| 3 | g1584.t3 | PANTHER | PTHR19305 | SYNAPTOSOMAL ASSOCIATED PROTEIN | 9 | 210 | 5.3E-88 |
| 1 | g1584.t3 | Pfam | PF00835 | SNAP-25 family | 95 | 146 | 1.1E-20 |
| 16 | g1584.t3 | ProSiteProfiles | PS50192 | t-SNARE coiled-coil homology domain profile. | 23 | 85 | 13.494 |
| 15 | g1584.t3 | ProSiteProfiles | PS50192 | t-SNARE coiled-coil homology domain profile. | 145 | 207 | 17.627 |
| 13 | g1584.t3 | SMART | SM00397 | tSNARE_6 | 18 | 85 | 3.5E-11 |
| 12 | g1584.t3 | SMART | SM00397 | tSNARE_6 | 140 | 207 | 9.9E-15 |
| 5 | g1584.t3 | SUPERFAMILY | SSF58038 | SNARE fusion complex | 13 | 83 | 8.05E-22 |
| 4 | g1584.t3 | SUPERFAMILY | SSF58038 | SNARE fusion complex | 135 | 207 | 1.88E-17 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K18211 (synaptosomal-associated protein 25)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
