General information for g15842.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Mpv17-like protein 2.
Parent gene
- The parent gene g15842 is located on chr_4: 6993136..6994564 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15842 | g15842.t1 | TSS | g15842.t1 | 6992560 | 6992560 |
| chr_4 | g15842 | g15842.t1 | isoform | g15842.t1 | 6992635 | 6993275 |
| chr_4 | g15842 | g15842.t1 | exon | g15842.t1.exon1 | 6992635 | 6992955 |
| chr_4 | g15842 | g15842.t1 | cds | g15842.t1.CDS1 | 6992635 | 6992955 |
| chr_4 | g15842 | g15842.t1 | exon | g15842.t1.exon2 | 6993018 | 6993275 |
| chr_4 | g15842 | g15842.t1 | cds | g15842.t1.CDS2 | 6993018 | 6993275 |
| chr_4 | g15842 | g15842.t1 | TTS | g15842.t1 | 6993346 | 6993346 |
Sequences
>g15842.t1 Gene=g15842 Length=579
ATGAGGAAGCTCATAGTTAGTATATACAAGAAAACAGCACAAGTTGTTGTTAAACAACAT
GATGATCTTTTTGGGAAGTATCTGTTATTAACCAACACAGTTTCAAGTGGATTGCTGATG
TATTTTGGAGAATATTGTGCACAAAAAATTGAAAATCATAAAAATAAAACTGAAAAAGAA
ATTGATAAAGAGAAAATGAAGCAATTGGCAGTTGTAGGTCTGAGTCAAGGACCATTGCAT
CATTATACGTACTTGTGGATGGAAAGATTATTGCCTGGAAATGCAGCATCGACAGTTGGA
AAGAAAATTTTAAGTGATCAATTCATTGTGTCACCAGTTTTTATTGTTCATTATTTCTAT
ACAGCGTACTTTCTTGAAGGAAAGAAAATTAGTCAAACAAATGAGCTCCTGAAAGAAAAA
TTTTTCAAAATCTACATAGCGGATTGGCTTGTATGGCCAGCGACTCAATTTATCAATTTT
TATTTTGTTCCATTAAAATATCGAGTGCTTTACATAAATATGATTACAATGTTTTATAAT
GTATTCCTGTGTTATGTGAAGAATGAGAAAAAGCATTAG
>g15842.t1 Gene=g15842 Length=192
MRKLIVSIYKKTAQVVVKQHDDLFGKYLLLTNTVSSGLLMYFGEYCAQKIENHKNKTEKE
IDKEKMKQLAVVGLSQGPLHHYTYLWMERLLPGNAASTVGKKILSDQFIVSPVFIVHYFY
TAYFLEGKKISQTNELLKEKFFKIYIADWLVWPATQFINFYFVPLKYRVLYINMITMFYN
VFLCYVKNEKKH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g15842.t1 | Coils | Coil | Coil | 47 | 67 | - |
| 2 | g15842.t1 | PANTHER | PTHR11266 | PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 MPV17 | 15 | 190 | 2.5E-70 |
| 3 | g15842.t1 | PANTHER | PTHR11266:SF81 | GH12661P | 15 | 190 | 2.5E-70 |
| 1 | g15842.t1 | Pfam | PF04117 | Mpv17 / PMP22 family | 124 | 184 | 7.5E-24 |
| 10 | g15842.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 26 | - |
| 15 | g15842.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 27 | 47 | - |
| 8 | g15842.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 48 | 67 | - |
| 16 | g15842.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 68 | 87 | - |
| 12 | g15842.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 88 | 106 | - |
| 13 | g15842.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 107 | 125 | - |
| 7 | g15842.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 126 | 144 | - |
| 17 | g15842.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 145 | 163 | - |
| 11 | g15842.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 164 | 168 | - |
| 14 | g15842.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 169 | 186 | - |
| 9 | g15842.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 187 | 192 | - |
| 5 | g15842.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 108 | 125 | - |
| 4 | g15842.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 167 | 186 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K13348 (protein Mpv17)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
