General information for g15914.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Elongation of very long chain fatty acids protein 5.
Parent gene
- The parent gene g15914 is located on chr_4: 7397850..7399511 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_4 | g15914 | g15914.t1 | TSS | g15914.t1 | 7397828 | 7397828 |
| chr_4 | g15914 | g15914.t1 | isoform | g15914.t1 | 7397850 | 7399511 |
| chr_4 | g15914 | g15914.t1 | exon | g15914.t1.exon1 | 7397850 | 7398013 |
| chr_4 | g15914 | g15914.t1 | cds | g15914.t1.CDS1 | 7397850 | 7398013 |
| chr_4 | g15914 | g15914.t1 | exon | g15914.t1.exon2 | 7398071 | 7398233 |
| chr_4 | g15914 | g15914.t1 | cds | g15914.t1.CDS2 | 7398071 | 7398233 |
| chr_4 | g15914 | g15914.t1 | exon | g15914.t1.exon3 | 7398548 | 7398719 |
| chr_4 | g15914 | g15914.t1 | cds | g15914.t1.CDS3 | 7398548 | 7398719 |
| chr_4 | g15914 | g15914.t1 | exon | g15914.t1.exon4 | 7399077 | 7399204 |
| chr_4 | g15914 | g15914.t1 | cds | g15914.t1.CDS4 | 7399077 | 7399204 |
| chr_4 | g15914 | g15914.t1 | exon | g15914.t1.exon5 | 7399261 | 7399368 |
| chr_4 | g15914 | g15914.t1 | cds | g15914.t1.CDS5 | 7399261 | 7399368 |
| chr_4 | g15914 | g15914.t1 | exon | g15914.t1.exon6 | 7399440 | 7399511 |
| chr_4 | g15914 | g15914.t1 | cds | g15914.t1.CDS6 | 7399440 | 7399511 |
| chr_4 | g15914 | g15914.t1 | TTS | g15914.t1 | 7399596 | 7399596 |
Sequences
>g15914.t1 Gene=g15914 Length=807
ATGACCAGTTTAATAAAAAATATTCAAGTTTATTTTAATTACTTAGAATCACTTAGTGAT
CCACGTTCAAAAGGATGGTTTATGGTTGATTCAGTAGTGCCAGCACTTTCGTGCTTCATA
ATTTACATTTTAATTGTTTTCATTGGACCAAAAATTATGAGAAATCGAAAACCTTTCAAG
CTCAATAACTTATTGATATTTTATAACTTTTTTCTGGTTGCTTTAAATCTTTACATCACA
TTAAAAATTTTAACTTCAGCTTATAAGTTGAATTATAAATTTTTTTGTCAACCATATCAA
AGGATTATATCAGAAAATGACATACAGATTGTCAAAGCAATGTGGCTTCTTTATATGTCA
AAAATTATTGAACTCAATGATACATTTTTCTTTATATTAAGAAAAAAAGATAGTCAATTA
TCATTTTTACATATTTATCACCATTCATTGATTGTTCTTGCTTTTTGGTTTGGGGTTAAA
TGGATACCAAGTGGAAGTGTTACATTAGGTTCAGCTGCAAATGCATTCGTTCATGTCGTC
ATGTATTTTTACTATGGATTATCAGCCATTGGAGTAGAGACAAAGAGAATTCTCTGGCTA
AAAAAATCTGTTACAATTATACAACTGATCCAGTTCACTGCTTTTATTTTATTTATGATA
AATGGATTTACTTTAAAATGTGAATTTCCTTTATGGATAATTTACATTCTTTTACCAAAT
TGCTTACTTTTTATTATACTTTTTGGACAATTTTATTTAAAAACATACACAAAAGATGAC
AAAAATTGCAAAAAGAAAATAAACTAA
>g15914.t1 Gene=g15914 Length=268
MTSLIKNIQVYFNYLESLSDPRSKGWFMVDSVVPALSCFIIYILIVFIGPKIMRNRKPFK
LNNLLIFYNFFLVALNLYITLKILTSAYKLNYKFFCQPYQRIISENDIQIVKAMWLLYMS
KIIELNDTFFFILRKKDSQLSFLHIYHHSLIVLAFWFGVKWIPSGSVTLGSAANAFVHVV
MYFYYGLSAIGVETKRILWLKKSVTIIQLIQFTAFILFMINGFTLKCEFPLWIIYILLPN
CLLFIILFGQFYLKTYTKDDKNCKKKIN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g15914.t1 | PANTHER | PTHR11157 | FATTY ACID ACYL TRANSFERASE-RELATED | 6 | 265 | 8.1E-80 |
| 3 | g15914.t1 | PANTHER | PTHR11157:SF12 | ELONGATION OF VERY LONG CHAIN FATTY ACIDS PROTEIN 4 | 6 | 265 | 8.1E-80 |
| 1 | g15914.t1 | Pfam | PF01151 | GNS1/SUR4 family | 28 | 261 | 2.4E-57 |
| 17 | g15914.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 24 | - |
| 25 | g15914.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 25 | 49 | - |
| 13 | g15914.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 50 | 60 | - |
| 24 | g15914.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 61 | 81 | - |
| 16 | g15914.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 82 | 114 | - |
| 19 | g15914.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 115 | 133 | - |
| 12 | g15914.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 134 | 144 | - |
| 23 | g15914.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 145 | 163 | - |
| 18 | g15914.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 164 | 174 | - |
| 22 | g15914.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 175 | 192 | - |
| 14 | g15914.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 193 | 203 | - |
| 21 | g15914.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 204 | 223 | - |
| 15 | g15914.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 224 | 228 | - |
| 20 | g15914.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 229 | 253 | - |
| 11 | g15914.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 254 | 268 | - |
| 9 | g15914.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 26 | 48 | - |
| 8 | g15914.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 61 | 83 | - |
| 4 | g15914.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 114 | 133 | - |
| 7 | g15914.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 140 | 159 | - |
| 5 | g15914.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 169 | 191 | - |
| 10 | g15914.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 203 | 225 | - |
| 6 | g15914.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 231 | 253 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K10249 (elongation of very long chain fatty acids protein 4)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed